KEGG   Oryctolagus cuniculus (rabbit): 100008661Help
Entry
100008661         CDS       T03373                                 

Gene name
RAD51
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  
DNA repair protein RAD51
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
Homologous recombination
Fanconi anemia pathway
Pathways in cancer
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    100008661 (RAD51)
   03460 Fanconi anemia pathway
    100008661 (RAD51)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100008661 (RAD51)
   05212 Pancreatic cancer
    100008661 (RAD51)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Others
    100008661 (RAD51)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    100008661 (RAD51)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     100008661 (RAD51)
    RecA family proteins
     100008661 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100008661 (RAD51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
17
AA seq 339 aa AA seqDB search
MAMQMQLEANADTSVEEESFGPQPVSRLEQCGINANDVKKLEEAGFHTEEAVAYAPKKEL
INIKGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVTVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcagatgcagcttgaagcaaatgcggatacttcggtagaagaagaaagcttt
ggcccacagcctgtttcacggttagagcaatgtggcataaatgccaatgatgtgaagaaa
ttggaagaagctggatttcatactgaggaggctgttgcctatgcaccaaagaaggagtta
ataaacattaaaggaattagtgaagcaaaagctgataaaattctgactgaggcagctaaa
ttggttccaatgggttttaccactgcaactgaattccaccaaagacgatcagagatcata
cagattactactggctccaaagagcttgacaaactacttcaaggtggaattgagactgga
tctatcactgagatgtttggagaatttcgaaccgggaagacccaaatctgtcatacactg
gctgtaacatgccagcttcccattgaccgaggtggaggtgaaggaaaggccatgtacatt
gataccgagggtacctttaggccagaacggctattagcagtggctgagaggtatggcctc
tctggcagcgatgttctggataatgtagcctatgctcggggcttcaacacagaccaccag
acccagctcctgtatcaagcatcagccatgatggtagagtccaggtatgcactgcttatc
gtagacagtgccaccgccctctacagaacagactactcgggtcgaggtgagctctcagcc
aggcagatgcacctggccaggtttctacggatgcttctgcgacttgctgatgagtttggt
gtaacagtggtcatcaccaaccaggtggtagcccaagtggatggagcagccatgtttgct
gcagatcctaaaaagcctattggaggaaatatcatagcccatgcatcaacaaccagactg
tacctgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccttgtctt
cctgaagctgaggccatgtttgccatcaatgcagatggagtgggagatgccaaagactga

DBGET integrated database retrieval system