KEGG   Oryctolagus cuniculus (rabbit): 100355792Help
Entry
100355792         CDS       T03373                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100355792 (ABHD6)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100355792 (ABHD6)
Peptidases [BR:ocu01002]
 Serine Peptidases
  Family S33
   100355792 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
9
AA seq 338 aa AA seqDB search
MMDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEGYQ
FCYSFRGRPGSKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDL
SIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGHVAGVYAAYYPSDIASLCLVCPAGLQYS
TDNQFVQRLKELQDSAAMQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRLPH
NNFYRKLFLEIVSEKSRYSLHKNMDKIKVPTQIIWGKQDQVLDVSGADVLAKSITNCQVE
LLENCGHSVVMERPRKTAKLMVDFLASVHNTDNNKKLD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatggatctggacgtggttaacatgtttgtgatcgcggggggaactctggccatccca
atcctggcatttgtagcctcattcctcctgtggccctcggctctgatcagaatctactat
tggtactggcggaggacgctgggcatgcaggtgcgctacgttcaccacgaaggctatcag
ttctgctattccttccggggcaggccggggtccaagccctccatcctcatgctccatgga
ttctccgcacacaaggatatgtggctcagcgtggtcaagttccttccgaagaacttgcac
ttggtctgtgtggacatgccaggacatgagggaaccacccgctcctccctggatgaccta
tccatagatggacaagtcaagaggatacatcagtttgtagaatgcctgaaactgaacaaa
aagcccttccatctagtgggcacctccatgggcggccacgtggctggtgtgtatgctgct
tactacccatcggatattgccagcctatgtctcgtgtgccctgctggcctgcagtattca
actgataatcagtttgttcaacggctcaaagaactacaagactcagctgccatgcagaag
atccctctgatcccatccaccccggaagagatgagtgaaatgctccaactctgctcttac
gtccgcttcaaggtgccccagcagatcctgcagggcctcgtggatgtccgcctccctcac
aacaacttctacaggaagttgtttttggaaatcgtcagtgagaagtccagatactccctg
cacaagaacatggacaagatcaaggttcccacgcagatcatctgggggaagcaagaccag
gtgcttgatgtgtctggggcggatgtgttggctaagtcaatcaccaactgccaggtggag
cttctggaaaactgtgggcactcggtggtgatggagagacccaggaagacagccaagctc
atggtcgactttctagcctctgtgcacaacacagacaacaacaagaagctggactga

DBGET integrated database retrieval system