KEGG   Olea europaea var. sylvestris (wild olive): 111377104Help
Entry
111377104         CDS       T05244                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    111377104
   00500 Starch and sucrose metabolism
    111377104
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111377104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 671 aa AA seqDB search
MSSIFKLISLSNPMATYSSRTPPYDLENSTSYTPIPDKPAASFAPAGHWRSKKLFAGILV
SSFLLLSLVLLFVNQQPDPQTKVNGTNQEDSSTPKSISPTARTSPPSRGVSQGVSDKTFR
LAGGENVTYAWTNVMLSWQRTAYHFQPEHNWMNDPNGPLFHKGWYHLFYQYNPESAVWGK
ISWGHAVSKDLIHWLYLPFAMVPDHWYDINGVWTGSATILPDGQIVMLYTGDTYDAVQVQ
CLAYPANLSDPLLLGWVKYSGNPVLVPPPGIGVKDFRDPTTAWLTPDGYKWRITIGSKFN
KTGISLVYETVDFKSYDMLDGYLHAVPGTGMWECVDFFPVSMTEVNGLDTSVNGPGVKHV
LKASLDDDKNDYYALGVYDPFENKWIPDDPELDVGIGLRYDYGKYYASKTFYDQITQRRI
LWGWIRETDSEDDDVLKGWASVQSIPRTVVFDQKTGSNIIQWPVSKVEELRSESVEFDNM
KLGPGSIVPLRADTPSQLDIVASFEIVKEAFEGTVESNVDSSYSCPTSGGAANRGKLGPF
GIIVLADETLSEGTPIYFYVTANGKAETHFCADELRSSEASDVAKVVYGSKVPVLDGEKY
SLRSLVDHSIVESFAQGGRRVITSRIYPTKAINGAARVFLFNNATGVSVTASGKIWNMIS
ADIRRFPFNQL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatattcaagctaatctccctctccaatccaatggccacctactcttcccgg
acgccgccatatgatcttgaaaactccacctcctacactcccatcccagacaaacccgcc
gcctccttcgctcccgctggccactggagatcgaagaagcttttcgccggcattctcgtt
tcatcttttctcttactctctttagttcttctgtttgttaaccagcagccggatcctcag
accaaagtcaatggcaccaatcaagaagattcttcaactcccaaatccatatcgccgaca
gctcgaacttcgccgccgtcaagaggggtgtcgcagggggtatcggataagactttccgg
ctggcaggcggcgaaaatgtaacctacgcgtggactaatgttatgctgtcttggcaacga
acggcttaccattttcaaccagaacataattggatgaatgatccaaatggtccattattt
cacaagggatggtaccatttgttctatcaatacaatccagaatcagctgtatggggaaaa
atttcatggggccatgctgtatcaaaggatcttatccattggctctacctaccatttgcc
atggtccctgatcattggtacgatatcaatggagtctggaccgggtccgccacaatcctt
cccgacggtcagattgtgatgctttacaccggagacacatacgatgctgtgcaggtgcag
tgtttagcgtaccctgccaacctatctgatcctctcctccttggttgggtcaagtattcg
gggaacccggttctggttcccccacctggtattggagtgaaggactttagggacccgact
accgcttggcttaccccggatgggtataaatggcggatcacgattggatccaagtttaat
aaaacgggtatttcccttgtgtatgagactgttgattttaaaagttatgatatgttagat
gggtatttgcatgcggttccgggtacgggtatgtgggagtgtgtggacttcttcccggtt
tcaatgaccgaagtaaacgggttggacacgtcggtaaacgggccgggtgttaagcatgtg
ctgaaagcaagtttggatgatgacaaaaatgattattatgcacttggtgtatatgacccg
tttgagaataagtggataccggatgacccggaattggatgtgggtattgggctaagatat
gattatggaaaatattatgcttcaaagacattttatgatcagattacgcagaggagaatt
ttgtggggttggattagagaaactgatagtgaagatgatgatgttttgaagggatgggca
agtgttcagtcgattcctagaaccgtcgtgttcgaccagaagacaggtagtaatataatt
caatggccagtgagcaaagtggaagaattgagatcagaaagcgttgaatttgacaatatg
aagcttggaccgggatccattgttccacttagagctgacacaccttcacagttggacata
gttgcctcatttgaaattgttaaggaggcatttgaaggaacagttgaatctaatgttgat
tctagttacagttgcccaacaagtggtggtgctgctaatagggggaaattgggaccattt
ggcattatcgttcttgctgatgaaacgctatcagagggaacccccatctacttctacgtt
accgctaatggaaaggccgaaacccatttttgtgctgatgaattgagatcgtcagaggct
tcggatgttgccaaagtagtatatgggagcaaagttcccgtccttgatggtgaaaaatac
tcactgagatcgttggttgatcactccattgtggagagctttgctcaaggaggcagaaga
gttataacctcgcgaatatatccaacaaaggccattaatggagctgcacgagttttcttg
tttaacaatgcgactggagtgagtgtcacagcatctgggaagatatggaacatgatttct
gctgacattcgtcgcttccccttcaatcagttgtga

DBGET integrated database retrieval system