KEGG   Owenweeksia hongkongensis: Oweho_0152Help
Entry
Oweho_0152        CDS       T01677                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
oho  Owenweeksia hongkongensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:oho00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Oweho_0152
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Oweho_0152
Enzymes [BR:oho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Oweho_0152
Two-component system [BR:oho02022]
 CheA family
  CheA-CheYBV
   Oweho_0152
Bacterial motility proteins [BR:oho02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Oweho_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(167871..168464)
Genome map
AA seq 197 aa AA seqDB search
MNQKAAFIKKSNNIVVIGASAGGIIALKTIFGQIKKPLNCPVLVVIHRPKQGSHKLDEVL
GYSSNLTIKEASNQEPMLDGIIYLAASNYHLLVENDGTLSLSLSDRVNFSRPSIDVTFYN
VVKQFGNRVTGIILTGANEDGAFGLGAIASAGGKTIVQKPQEAQISVMPEAALKMAPDSK
QLTLHEISNYLLSNFSS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccagaaagcagcatttataaaaaagtcaaataacatcgtggtgattggtgccagt
gctggcggaatcattgcactaaagaccatttttgggcaaattaaaaagcctttaaattgt
cctgtacttgtcgttattcacagacctaaacaaggcagccacaagttagacgaggtactt
ggctattcttcaaatctaactataaaggaggcctccaatcaggagccaatgctggatggt
ataatttatcttgccgccagcaattatcatttattagttgagaatgacggcacactttca
ctaagtttgagtgaccgggtaaactttagccgaccctcaatagatgttactttttacaat
gtggtaaaacaatttggcaatcgtgtaacaggcattatccttaccggagctaacgaagat
ggcgcctttggacttggagctattgcgagtgcaggaggaaaaactatcgttcaaaaaccc
caggaagcacagatttcggtaatgccggaagctgcattaaaaatggctcctgactcgaaa
caactgacgctgcatgaaatttctaactatctcttgtcaaactttagctcatag

DBGET integrated database retrieval system