KEGG   Owenweeksia hongkongensis: Oweho_0197Help
Entry
Oweho_0197        CDS       T01677                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
oho  Owenweeksia hongkongensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:oho00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:oho00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
217210..217818
Genome map
AA seq 202 aa AA seqDB search
MRNIVLAFAGFGILTACNRTEPTASASQETVELAINTENTMEEMSFYDFKTKTLTGEEFD
FSNLQGKRVLIVNTASECGFTPQYEQLQELYKEFGGEKFTIIGFPSNDFGKQEPGSNEEI
ATFCEKNYGVTFPMMDKTPVKGDDQHEVYSWLTHKDQNGVDDAKVSWNFNKFLVDENGKW
VAHYGSKTSPLDEEIMNFAEGK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatatagtattggcttttgcaggatttggaattttgacagcttgcaatcgaact
gaaccaacggcaagcgcaagtcaggaaactgtagaattagctataaacactgaaaacacg
atggaagaaatgagtttttatgactttaaaaccaaaaccctgacgggtgaggagtttgat
ttttctaatctacaaggtaagcgtgtactgattgtaaacaccgctagtgagtgcggtttt
actccgcagtacgaacagcttcaagaactttataaagagtttggtggagagaaattcacc
attattggatttccatcaaatgattttggaaagcaggagccgggaagcaatgaggaaatt
gccacattttgcgaaaaaaattacggggttacttttcctatgatggacaaaactccggta
aagggagatgaccaacatgaagtatattcatggcttacccacaaggaccaaaatggagtg
gatgatgccaaggtgagttggaacttcaacaagtttttggtagacgaaaacggaaaatgg
gtggcgcattatggtagtaagacttcacctttggatgaggagattatgaattttgcagaa
gggaaatag

DBGET integrated database retrieval system