KEGG   Owenweeksia hongkongensis: Oweho_0446Help
Entry
Oweho_0446        CDS       T01677                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
oho  Owenweeksia hongkongensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Oweho_0446
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Oweho_0446
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Oweho_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
468300..468794
Genome map
AA seq 164 aa AA seqDB search
MNFYDLEALTPSGKPIKMSDYKGKVVLIVNTATQCGLTPQFEGLEKLHQQYKGQGLVVLG
FPCNQFGGQEPLSNDEMESTCQVNHGVSFQLTEKVDVNGPGTHPVFKYLKSKFWSILGRS
IKWNFTKFLVGPDGKPYQRYAPTTKPEKLEKDILKLLKTTKATA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttacgatttagaagctttgacaccaagcggcaagcccataaaaatgagtgac
tacaaaggtaaggttgtacttattgtaaatacagcaactcaatgtggtttaacccctcag
tttgaaggtttggaaaaactacaccaacaatacaaaggtcaagggctggttgtattaggt
ttcccctgtaatcagtttggcgggcaagaacctttgagtaatgatgaaatggaaagtacc
tgtcaggtgaatcacggggtgagttttcagcttactgaaaaggtggacgtgaatggccct
ggtactcacccagttttcaaatatttgaagagtaagttttggtcaattttgggaagaagt
atcaaatggaattttaccaaatttttggttggaccagatggaaagccctaccaaagatat
gctcctaccaccaagccagaaaagctagaaaaagacattttgaaattattaaaaacaaca
aaagctacagcatga

DBGET integrated database retrieval system