KEGG   Owenweeksia hongkongensis: Oweho_0483Help
Entry
Oweho_0483        CDS       T01677                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
oho  Owenweeksia hongkongensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513357..514457
Genome map
AA seq 366 aa AA seqDB search
MSMKKIVILTLVAGLAIVSAQSCKKEPTSDSSVEYDTTPYRLAIGDFEEPSIAPDNELTK
QGVLLGRMLFYEKKLSKDGSMSCASCHRQEHAFTDTARLSIGVEKLPGKRQAMAVFNMAW
HNNEFFWDGRSHLLRDQSLMPIQDPLEMNETLENNVAKLKAEKQYRDQFMRAFGSEEITS
EKMSLALEQFMNSIVSVESKYDRFLRGEATLTASEERGRALFFDEFNPGFPSLSGADCAH
CHTTRTFENDLYMNNGLDSDANMQDIGREEVTGNASDRGKFKVTSLRNVEVTAPYMHDGR
FKALEEVVEHYNSGIKASSTVDPALDYTRVSGGLQLTAQDKADLVAFLKTLTDEVLLTNP
EYSDPF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgaagaaaattgtaatcctaacacttgtggctgggctggctattgtgagtgca
caatcatgcaaaaaagaaccaacaagtgacagcagcgtggagtatgataccacaccctat
aggctggccattggcgattttgaagagccaagtatagcaccggataatgaacttaccaag
cagggcgtactgcttggtagaatgttgttttacgaaaagaagctttctaaagacgggagt
atgtcttgcgccagctgccatcgacaggaacatgcttttacagatacggctaggctctct
attggagtagaaaaacttccaggaaagaggcaggccatggctgtgtttaacatggcgtgg
cataacaatgaattcttttgggatggtagatcacatttgttacgtgatcaatccttaatg
cccattcaggatcctttggaaatgaatgaaaccttagaaaataatgtggctaagctcaag
gctgaaaagcaatatcgtgatcagtttatgcgtgcttttggaagtgaggaaatcacttct
gagaaaatgtctttggcgcttgagcagtttatgaattccatagtttcagtagagagtaag
tatgaccgttttctgcgaggagaagctactttgactgcaagtgaagaacgtggccgagct
ttgttttttgatgagtttaacccaggttttcctagcctttcgggagcagattgtgctcat
tgccataccacacgaacttttgagaatgacttatatatgaacaatggtttggatagcgat
gcaaatatgcaggatataggtcgagaggaagtaactggtaatgcctcagatcgtgggaaa
tttaaagttacgtctttgcgcaatgtagaggttacagctccatatatgcatgatggtagg
ttcaaggctttggaagaagtggtagaacactacaatagtggaatcaaggcttcatctaca
gttgatcctgcactggattatacaagagtatcaggcgggctgcaattgactgcccaagac
aaagccgatttagttgcttttctaaaaaccttgacggatgaggttttacttactaaccct
gagtatagcgatcccttttaa

DBGET integrated database retrieval system