KEGG   Owenweeksia hongkongensis: Oweho_0484Help
Entry
Oweho_0484        CDS       T01677                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
oho  Owenweeksia hongkongensis
Brite
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Oweho_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
514464..515504
Genome map
AA seq 346 aa AA seqDB search
MKTDFTGNRRILVAAILLPSIFFLACKKEAIPQLQGRGIMVIPEGFPEMPFPEDNQFSRE
RWELGKKLFYDPILSVDNSISCASCHKANLAFADDRDFSPGVENRPGVRNAPSLANVGYH
PYYLREGNVPTLEMQVPVPVQEENEFAHNMVLIAELLSANAEYQKMATEAYNREVDPFVI
TRALATFQRSLISGNSRYDKYHFQGDKTVLSESEKRGMQLFFSERAKCGSCHGGFNFTDY
SFQNNGLDTVYSDPGRMRLTGLPGDESLFKVPSLRNVEVTAPYMHNGKFQTLMDVVEHYN
SGGKNHPNKSSRVQELNLSQQEKIDLAAFLESLTDDEFISNTLFKE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgattttacaggaaataggagaatattggtggcagcaattttgttgccatcc
atattctttttggcttgtaagaaggaagccataccgcagctacagggtagaggtataatg
gttattccagaaggctttcctgaaatgccatttcccgaggataatcagtttagtagggag
agatgggaactgggcaaaaagctcttttacgatcctattttatccgtggataactccatt
agctgtgccagttgtcacaaggcaaatttggcatttgccgatgatagggattttagccct
ggcgtagaaaaccggcccggggtaagaaatgccccttcacttgccaatgtgggctatcac
ccatattatttgcgagagggaaatgtgcctactttagaaatgcaggtgccagtgcccgtg
caggaagagaatgagtttgcacataatatggtgctcatcgctgagttgttatctgctaat
gcggaatatcaaaaaatggcgactgaggcttataatcgcgaagtagatccttttgtgatt
actcgtgcccttgctacttttcagcgtagccttattagtggaaacagtagatacgataag
tatcattttcaaggtgataaaaccgttttaagcgaaagcgaaaaaagagggatgcaactt
ttttttagtgaaagagccaaatgtggaagctgtcatggcgggtttaatttcacggattat
tcttttcaaaataatggcttggatacggtgtatagcgatcccggtagaatgcggttgact
gggttaccgggagatgagtcactttttaaagtgccatccttacgcaatgtggaagttact
gcgccatatatgcacaatggtaagtttcaaactttgatggatgtagtggagcattataat
tcgggtggaaaaaatcatccgaacaagagctcccgtgtgcaagaactgaacttatcgcaa
caggaaaaaattgatttggcggcttttttagagagtcttactgatgatgaatttatcagt
aatacattgttcaaagaatag

DBGET integrated database retrieval system