KEGG   Owenweeksia hongkongensis: Oweho_0507Help
Entry
Oweho_0507        CDS       T01677                                 

Definition
(GenBank) cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
oho  Owenweeksia hongkongensis
Brite
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Oweho_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 Cytochrom_C1 Cytochrom_C550 Cytochrome_P460 MVP_shoulder GatB_N Haem_bd
Motif
Other DBs
NCBI-ProteinID: AEV31523
UniProt: G8QZS9
Position
complement(541648..542658)
Genome map
AA seq 336 aa AA seqDB search
MVGVLFLISSCRPDKTELQPVSFVGFERPGHFPAPHYNFKNNPVTKDGFELGRKLFYDPI
LSASGSISCGSCHLPEAGFADPGKAKSEGIDGLLGKRNSPALANLAWFPSFMADGGINHI
EVMPIAPITDSAEMGSSLAKTMLTLNASPTYRKLFKQAFDVDSISDQKLLFALAQFMSMM
ISSESKFDEHLQGKNVFNESEKRGYKIFQQHCVSCHSGALTTDFSFKNNGLDITSADLGR
ARITQDENDRGKFKVPSLRNVELSYPYMHDGRFKTLDAVIDHYTTSIQPTPNLAEELQEP
IILTNNEKQDLVKFLTTFTDYNYITKPSLAKSKQNL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggtgtcctttttcttatctcatcctgtagaccagacaaaactgagttacaacca
gtcagttttgtagggtttgaaagacctgggcactttcctgctcctcattataattttaaa
aacaatcctgtaaccaaagatggctttgagttaggtcgcaaacttttttacgatcctatc
ttatcggcatctggttcaatttcctgtgggtcatgtcatcttcctgaagccggttttgct
gatcctggtaaggccaaaagtgaaggaattgatggacttcttggaaaacggaactccccc
gccctggctaatttggcttggtttccctcatttatggcagatggtggaataaatcacatt
gaagtgatgcctattgcaccaattaccgattctgccgaaatgggcagcagtcttgcaaaa
actatgcttacacttaatgccagccctacttatcgcaaactctttaagcaagcttttgat
gtagatagcatttcagatcagaaactgcttttcgctttagctcagtttatgagtatgatg
atttcttctgaaagtaagtttgatgagcacctacaaggcaaaaatgtgtttaacgaaagt
gagaagcgcggctataagatttttcaacagcattgcgtttcatgccacagcggtgcactg
accactgattttagttttaaaaataacggcttggatattacttctgccgacttgggaaga
gctcggattactcaagacgaaaatgatagaggaaagtttaaagttcccagtttacgtaat
gtagaactgagctatccatatatgcacgatggacgttttaaaactttggatgcggttatt
gaccactacaccaccagtatacagccaactcctaatttagcggaagagcttcaggagccc
atcattcttacaaataatgagaagcaggatttagtgaaatttcttaccacctttacggac
tataattatattacaaaaccatcgcttgccaagagcaagcaaaacttatag

DBGET integrated database retrieval system