KEGG   Owenweeksia hongkongensis: Oweho_0709Help
Entry
Oweho_0709        CDS       T01677                                 

Definition
arginase family hydrolase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
oho  Owenweeksia hongkongensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oweho_0709
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Oweho_0709
Enzymes [BR:oho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Oweho_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(745884..746834)
Genome map
AA seq 316 aa AA seqDB search
MAKKLQFLSIMSELGAGTRGASLGFPALEIASLKYDPEFFPKYSIKEVETDNNLVFKKKT
LKFGKRLDGIARMYRNIQDEVAATFNDKKFPVVFSGDHSNAGGTIAGIKAAYPTKRLGVI
WVDAHGDLHSPYTSPTGNVHGMPLATALHEDNLENKNNDPQEETIWYWNEMKGSNQRVKH
SDLFFVGLRDLEQPEINLMTKHNIPNVTVDELREMGVKAVAEKALIYLKDCDIIYISFDV
DSMDPSVSRGTGTPVEHGLTEDEARDLLLHLVEDERLCCFETTEVNPLLDDKGNSMAEAA
FRVIKPVIEKIESNLK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagctacaatttttaagtatcatgtctgagcttggtgctggaaccagaggt
gcgagtcttggttttccggccttggaaatagctagtctaaagtatgacccagagtttttt
ccgaagtattctattaaagaagtagagacggataacaacttggtcttcaaaaagaaaact
ttaaaatttgggaaacgactggacggtattgctcgcatgtaccgaaatattcaggacgag
gtagctgccacttttaatgataagaagtttcctgttgttttttctggtgatcacagtaat
gcagggggaactatcgcaggcataaaagcggcttatccaaccaagcgtcttggtgtgatt
tgggtagatgctcatggcgaccttcactcaccatacaccagccctactggtaatgtacac
ggcatgccattggcaactgctcttcatgaagacaatcttgaaaataagaataacgaccct
caagaggaaaccatttggtactggaatgaaatgaagggtagtaatcagcgcgtgaagcac
agcgatcttttctttgtaggattgcgtgatttggaacagccggaaattaatttaatgact
aagcataatattccaaatgtaaccgtggatgaacttcgcgaaatgggtgtgaaagctgtg
gctgaaaaggcactaatctatctgaaagactgtgatatcatttatatttcttttgatgta
gacagtatggatcctagtgtgagtagaggcacagggactccggtggagcacggtcttact
gaagatgaagctcgagacctcttactacatcttgtagaagatgagcgtctttgctgcttt
gaaactaccgaagtgaatcctttgcttgatgataaaggaaactccatggccgaagccgct
tttagagtgataaagccagtaattgaaaaaatagaatccaacttaaagtaa

DBGET integrated database retrieval system