KEGG   Owenweeksia hongkongensis: Oweho_0738Help
Entry
Oweho_0738        CDS       T01677                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
oho  Owenweeksia hongkongensis
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Oweho_0738
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Oweho_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790325..792667
Genome map
AA seq 780 aa AA seqDB search
MKKLSRPITELKNSYDVLVIGSGYGGSIAASRMSRIGKSVCLLEKGKEFLPGDFPSKLTE
ASGEMNFNMGKKSDDNNGLYDFTMGDGISVFKGCGLGGTSLVNANVSIKPEPRVMEDNAW
PAEIRNNISSFHEGVERAWDMLKPNPYPEGKNGYPILAKTEAMRKSADYMSEEFRLLDIN
VNFENKEENHVGIKQGKCNNCGDCVTGCNVGAKNTTAMNYLPDAYNHGAEIFTNIDVRHI
EKSNGRWKVFFNVLNTGREKFDAPELFVFADNVIISAGSLGSTEILLRSKAKGLSTSDML
GQNMTGNGDVLAFGYNNDQPINGIGMGDNEIKDIANVGPCITSVIDMRNRDNIVDGMTLE
EGTVPAPIRAIMASTLVTVSRLFGNDTDRGFKDFWREKWREITSLFKGPFHGAVNHTQIY
LVMTHDDSKGKMSLKDDRLKIDWPGVGKQEIFKKVDGELTAATSALGGNKVPNPTWNKMM
DFDLVTVHPLGGCGMANDANTGVTDHKGQVFSGSTGTDLHPGLYVMDGAVIPKSVGTNPL
LTISGLAERSCKLIAESMGASINYSFENAPRKEGQNNVTKGVQFTETMRGYFSLDEKENY
QRGHDKGKAAKSPFEFTLTIHSEDVDTFVQNKDHQAGLMGSMVAPALSDKPLSALNGTFN
LFVEDKANPDTKKMLYSSVLTDVNGEHYYFEGFKQVQNDKGFDVWADTTTLFITLRKGDS
KEGEVIGKGMLKILIKDFMTQLTTMKSVNTKGASESISSIAAFGKFFSGNVFDTYIKKIR
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactatcacgccccattacggaattaaaaaacagctacgatgtactcgtaata
ggctctggatatgggggtagcattgcggcatctcggatgagccgcatcggaaagtcggtt
tgtcttttagaaaaaggtaaagagtttttacctggagatttccctagtaagctcacagaa
gcttctggagaaatgaattttaacatgggtaaaaaatcagatgataataatgggctttat
gattttaccatgggcgatggcatcagtgttttcaaaggttgtgggttgggaggaacctct
ttagtaaatgccaatgtttcgataaagcctgagcctcgggtaatggaagacaatgcatgg
cccgctgaaatcagaaacaacatttcttcttttcatgaaggtgtagagcgcgcttgggat
atgctaaaacccaatccataccctgaaggtaaaaatggctaccccattttggccaaaacc
gaggccatgagaaagtcagcggattatatgtctgaggaatttagactgctggacatcaac
gtaaactttgaaaacaaagaggaaaatcatgttgggataaaacaaggtaaatgcaacaat
tgtggagattgtgtaacaggctgcaacgtaggcgccaaaaatacaacagccatgaattac
ctcccggatgcttacaatcatggtgcagaaatatttaccaatattgatgttcgccatatt
gagaaaagcaatggccgctggaaggtgttttttaatgtgttgaatacaggaagggaaaaa
tttgacgcacctgaactatttgtatttgcagataatgtaatcataagtgccggctcttta
ggctccaccgaaatactgcttcgttccaaggcaaaaggtctaagcacctcagatatgctt
gggcaaaatatgactggaaatggcgatgtattggcctttggctacaataatgaccagcca
ataaatggtataggaatgggcgataatgaaataaaggatatcgcgaatgtgggcccctgt
atcacaagtgtgatagatatgcgaaatcgtgataacattgtcgatggcatgacgctcgaa
gaaggtaccgttcctgctccaattcgtgctattatggcaagtacgctggttacagtttcc
cgccttttcggaaatgataccgatagaggatttaaagatttttggcgtgaaaagtggcgc
gaaatcaccagcttatttaaagggccatttcacggtgcagtaaatcacacacagatttat
ttggtgatgacgcatgatgattcaaaaggtaaaatgagcctgaaagatgatcgattaaaa
atagactggccaggtgtgggcaagcaagaaatatttaaaaaagtagatggcgaactaact
gctgccacctcggcccttggcgggaataaagttccaaacccaacctggaataagatgatg
gattttgatctggttacggttcacccactgggcggctgcggtatggccaacgatgccaat
accggagtgacagaccataaaggccaggttttttcgggaagcactggaacggatttacac
cccggactttatgtgatggatggagcggtgattccaaaatctgttggtaccaatcctctc
ctcaccattagcggtttagctgagcgcagctgcaaactaattgcagaaagtatgggtgct
tctattaattatagctttgaaaatgctccccgaaaagaaggccaaaacaatgttaccaaa
ggtgtgcagtttactgaaaccatgcgcggctatttttcgcttgacgaaaaagaaaactac
cagcgtggccatgataaaggaaaagcagcaaaatcaccttttgaatttacccttaccata
cattccgaagatgtggacacttttgtgcaaaacaaagaccaccaggccggactgatggga
agcatggtagctcctgccctttcggacaaaccactttcagcgcttaatggaaccttcaac
ctttttgtagaagacaaagcaaatccagacaccaaaaagatgctatatagcagcgtattg
acggacgtaaatggtgagcactattattttgaaggatttaagcaagtgcaaaacgacaag
ggatttgatgtgtgggcagacaccactaccctgtttatcactttacgtaaaggtgattct
aaagaaggtgaggtgattggcaaggggatgcttaaaattttgatcaaagattttatgacg
caacttaccaccatgaaatctgtgaataccaaaggtgccagtgagagtatttcgtctatc
gcggcattcggtaagttcttttcaggaaatgtgtttgatacgtacattaagaaaatcaga
taa

DBGET integrated database retrieval system