KEGG   Owenweeksia hongkongensis: Oweho_0739Help
Entry
Oweho_0739        CDS       T01677                                 

Definition
glutaminase A
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
oho  Owenweeksia hongkongensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:oho00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:oho00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:oho00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
792739..793653
Genome map
AA seq 304 aa AA seqDB search
MDYNSIFEEIKREINLDVKHGKVADYIPELAHVDPNKFGISLKCMDGQSFSMGDADEKFS
AQSITKVFSLALAMNHFGQKVWSRMDVEPSGTSFNSLVLLEYEQGIPRNPFINSGALVIA
DMLVEKLEDPKGEFLEFVRNMTGSRDIDYNYKVANSERDHGFRNRAMANMLKSFGNIKGD
VEDVLDFYFHQCSIEMSCKQLADAFMVFSNKGSMLGTKEKIITKQQSQRINALMLTCGFY
DEAGEFAFRVGLPGKSGVGGGIAAVYPSEYSVAVWSPRLNKLGNSVLGMKTLELLTTKTG
MGIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggactacaactcaatttttgaagaaataaagcgggagattaacttggatgtaaagcac
ggaaaggtggccgattacattcctgaattagctcatgtagaccccaataagtttggaatt
tcattgaagtgcatggatggccaaagcttttctatgggcgatgctgacgaaaaattttcc
gctcaaagtatcactaaggtattttcattagccctagccatgaaccattttggccaaaaa
gtttggagccgaatggacgtagagccttccggaacttcattcaactcattggttctcctg
gaatatgagcagggaattccaagaaatccttttataaatagtggcgcactggtaatagcc
gatatgctggtagaaaagttggaagatcccaaaggtgagtttttggaatttgtgagaaac
atgaccggcagccgtgatatagactacaattataaagttgccaatagcgaaagagaccac
ggttttagaaatagagctatggctaatatgctcaagtcttttggaaacataaaaggtgat
gtagaagatgtgttagacttttactttcatcaatgcagtattgaaatgagctgtaagcaa
ttggctgatgcctttatggtttttagcaataaaggaagtatgctgggcaccaaagaaaaa
attataaccaaacagcaaagtcaacgtataaatgctctgatgcttacttgcggcttttat
gacgaagccggagagtttgcctttcgtgttggtctgcctggtaaaagtggtgtaggtgga
ggaatcgctgccgtatacccaagtgaatatagtgttgctgtttggagcccaaggctcaat
aaattgggtaattcggtactgggaatgaaaaccttggaattacttactaccaaaaccgga
atgggcattttttaa

DBGET integrated database retrieval system