KEGG   Owenweeksia hongkongensis: Oweho_0739Help
Entry
Oweho_0739        CDS       T01677                                 

Definition
glutaminase A
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
oho  Owenweeksia hongkongensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Oweho_0739
   00330 Arginine and proline metabolism
    Oweho_0739
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Oweho_0739
Enzymes [BR:oho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Oweho_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
792739..793653
Genome map
AA seq 304 aa AA seqDB search
MDYNSIFEEIKREINLDVKHGKVADYIPELAHVDPNKFGISLKCMDGQSFSMGDADEKFS
AQSITKVFSLALAMNHFGQKVWSRMDVEPSGTSFNSLVLLEYEQGIPRNPFINSGALVIA
DMLVEKLEDPKGEFLEFVRNMTGSRDIDYNYKVANSERDHGFRNRAMANMLKSFGNIKGD
VEDVLDFYFHQCSIEMSCKQLADAFMVFSNKGSMLGTKEKIITKQQSQRINALMLTCGFY
DEAGEFAFRVGLPGKSGVGGGIAAVYPSEYSVAVWSPRLNKLGNSVLGMKTLELLTTKTG
MGIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggactacaactcaatttttgaagaaataaagcgggagattaacttggatgtaaagcac
ggaaaggtggccgattacattcctgaattagctcatgtagaccccaataagtttggaatt
tcattgaagtgcatggatggccaaagcttttctatgggcgatgctgacgaaaaattttcc
gctcaaagtatcactaaggtattttcattagccctagccatgaaccattttggccaaaaa
gtttggagccgaatggacgtagagccttccggaacttcattcaactcattggttctcctg
gaatatgagcagggaattccaagaaatccttttataaatagtggcgcactggtaatagcc
gatatgctggtagaaaagttggaagatcccaaaggtgagtttttggaatttgtgagaaac
atgaccggcagccgtgatatagactacaattataaagttgccaatagcgaaagagaccac
ggttttagaaatagagctatggctaatatgctcaagtcttttggaaacataaaaggtgat
gtagaagatgtgttagacttttactttcatcaatgcagtattgaaatgagctgtaagcaa
ttggctgatgcctttatggtttttagcaataaaggaagtatgctgggcaccaaagaaaaa
attataaccaaacagcaaagtcaacgtataaatgctctgatgcttacttgcggcttttat
gacgaagccggagagtttgcctttcgtgttggtctgcctggtaaaagtggtgtaggtgga
ggaatcgctgccgtatacccaagtgaatatagtgttgctgtttggagcccaaggctcaat
aaattgggtaattcggtactgggaatgaaaaccttggaattacttactaccaaaaccgga
atgggcattttttaa

DBGET integrated database retrieval system