KEGG   Owenweeksia hongkongensis: Oweho_0971Help
Entry
Oweho_0971        CDS       T01677                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
oho  Owenweeksia hongkongensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:oho00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052504..1053988
Genome map
AA seq 494 aa AA seqDB search
MDIKKITNLGELKKSGYKPLTIKEELRKNLVENLKKGTTVFEGIHGFEHTVIPDLERAIL
SGHNINFLGLRGQAKTKMARMMTRLLDEYVPAISGSELSDDPLNPISKTALDIIAEKGDD
TPIYWIHRDERYYEKLATPDVTVADLIGDVDPIKAANLKLSYADERVIHFGMIPRANRSI
FVINELPDLQARIQVALFNILQEGDVQIRGFKLRLNLDIQFVFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPEDIETARKITAQEAKSNDDRNKTVIVPDVARNLLEQIAFEARDNEYI
DSKSGVSARLTITASENLVSTAERRNLVNGSDKTTIRLIDFLGVISSITGKVELVYEGEQ
EGAAMVAENLIGSAVRSLLGDYFPEMDHLKSGDKDNPYTQLIEWFGRGNSIDFLTDFTDK
EYQDILNSITPLPKLVNKYQQNTSDEEKYFLMEMVLWALAEYSKLNKERLVSGYNFSDLF
SSYLRGGELDIDLN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggatataaagaaaataaccaaccttggtgagctcaaaaaatcgggctacaaaccacta
accataaaggaagagcttcgaaagaatttagtagaaaacctaaaaaagggaactacggtt
tttgaaggtattcatggttttgaacacaccgtaattcctgacttggagcgagccatcctt
tcggggcataacattaactttttgggtcttcgtggtcaagccaaaacaaaaatggccagg
atgatgacgcgcctgctggatgaatatgttcctgcaattagcggttccgaactatccgat
gatcctctgaacccaatcagtaaaacggcattggacatcattgccgaaaaaggtgatgac
actcctatatattggatacatcgcgatgagcgctactatgaaaaattagccacgccagat
gttacagttgctgaccttattggtgatgtagatcctataaaagctgcaaatctaaagttg
tcttatgccgatgagcgcgtaattcactttggaatgattcctcgtgccaatcgcagcatt
tttgtaattaatgaattgcccgatttgcaagcacgtatccaggtggcactctttaatatt
ttacaggaaggagatgtgcagatccgtggttttaagcttaggcttaatttggatattcaa
tttgtatttaccgcaaaccctgaagattacaccaatcgtggatcaattgtaactccttta
aaagatagaattggtagtcagatattgacacactatcctgaggacattgagacagcgaga
aaaattaccgctcaggaagctaaaagcaatgacgaccgaaacaaaacggtaattgttcct
gatgtggcaaggaatctgttggagcaaattgcttttgaagcacgcgataatgaatatata
gattccaaaagcggagtatccgcaaggcttaccattacagcttcagagaacttggttagt
actgctgagcgcagaaacctcgtcaatggttctgataaaaccaccattcgtctgatcgac
tttttgggtgtgatatcttccattaccggaaaggtagaactagtatatgaaggcgaacaa
gagggagccgccatggtagccgagaacttgattggctctgcagtacgaagcctcttaggt
gattatttccctgaaatggatcatttaaaatccggagataaagacaatccatacacccag
cttattgaatggtttggtcgcggcaattcaattgatttcctaaccgactttactgataag
gagtatcaggatattttgaatagcattactcctcttccaaaactggttaataaataccaa
caaaatacatctgatgaagagaagtactttttaatggaaatggtattgtgggcattagct
gaatattccaaattgaacaaagaacgattggtaagcggatacaatttttcagatctcttt
agcagttacctgcgaggtggggagctagatattgatttaaactag

DBGET integrated database retrieval system