KEGG   Owenweeksia hongkongensis: Oweho_0993Help
Entry
Oweho_0993        CDS       T01677                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
oho  Owenweeksia hongkongensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oho00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Oweho_0993
DNA repair and recombination proteins [BR:oho03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Oweho_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1085137..1085772
Genome map
AA seq 211 aa AA seqDB search
MNFSSKYLEKAVDEISNLPGIGKKTALRLALHLLRQDKEAVGSLSEALLALKSKVNECQK
CGNLSDHNICEICANPTRNDELICVVEDVRDVMAIENTGQYRGLYHVLGGVISPMEGIGP
AELNIGSLINRVEQSTPKEIIFGLGTTMEGETTTFYLYKKLAGFDIKLSAIARGIAVGDQ
LEYADEVTLARSITNRVPYENSITQNQNSRA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttcttctaaatatttagaaaaagcggtagacgaaatttctaaccttccgggg
ataggaaagaaaacagccttgcgactggcgctacatttattacgccaggacaaagaagct
gtaggctcactttctgaagcattgcttgccttaaaaagcaaggtgaatgaatgtcaaaaa
tgtggtaacctttctgatcacaatatttgtgaaatatgcgccaaccctacccgaaatgat
gaactcatttgtgtggtagaagatgtgcgcgatgtaatggccattgaaaataccggtcag
tatcgaggattatatcacgttcttggcggtgtaatcagccccatggaaggcattggcccg
gctgagctgaatattggaagtttgataaaccgagtggaacaaagcactcccaaggaaatc
atctttggattgggcaccaccatggaaggcgaaaccacaactttttatctatataaaaaa
ctggcaggttttgacatcaaactatctgccatagcacgcggtattgccgttggcgaccag
ctggaatatgctgatgaagtaactttggcacgaagcatcaccaaccgcgtgccctacgaa
aattccattactcaaaatcaaaattcgcgagcttga

DBGET integrated database retrieval system