KEGG   Owenweeksia hongkongensis: Oweho_0993Help
Entry
Oweho_0993        CDS       T01677                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
oho  Owenweeksia hongkongensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:oho03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1085137..1085772
Genome map
AA seq 211 aa AA seqDB search
MNFSSKYLEKAVDEISNLPGIGKKTALRLALHLLRQDKEAVGSLSEALLALKSKVNECQK
CGNLSDHNICEICANPTRNDELICVVEDVRDVMAIENTGQYRGLYHVLGGVISPMEGIGP
AELNIGSLINRVEQSTPKEIIFGLGTTMEGETTTFYLYKKLAGFDIKLSAIARGIAVGDQ
LEYADEVTLARSITNRVPYENSITQNQNSRA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttcttctaaatatttagaaaaagcggtagacgaaatttctaaccttccgggg
ataggaaagaaaacagccttgcgactggcgctacatttattacgccaggacaaagaagct
gtaggctcactttctgaagcattgcttgccttaaaaagcaaggtgaatgaatgtcaaaaa
tgtggtaacctttctgatcacaatatttgtgaaatatgcgccaaccctacccgaaatgat
gaactcatttgtgtggtagaagatgtgcgcgatgtaatggccattgaaaataccggtcag
tatcgaggattatatcacgttcttggcggtgtaatcagccccatggaaggcattggcccg
gctgagctgaatattggaagtttgataaaccgagtggaacaaagcactcccaaggaaatc
atctttggattgggcaccaccatggaaggcgaaaccacaactttttatctatataaaaaa
ctggcaggttttgacatcaaactatctgccatagcacgcggtattgccgttggcgaccag
ctggaatatgctgatgaagtaactttggcacgaagcatcaccaaccgcgtgccctacgaa
aattccattactcaaaatcaaaattcgcgagcttga

DBGET integrated database retrieval system