KEGG   Owenweeksia hongkongensis: Oweho_0996Help
Entry
Oweho_0996        CDS       T01677                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oho  Owenweeksia hongkongensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oweho_0996
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oweho_0996
  Amino acid metabolism
   00310 Lysine degradation
    Oweho_0996
Enzymes [BR:oho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Oweho_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089467..1090813
Genome map
AA seq 448 aa AA seqDB search
MAQVELIMPKMGESVAEATIIKWLKEEGDTIDMEESVLEIATDKVDSEVPSPTEGVLLKK
LFGEDDVVKVGDPIAIIETEGGASENGAAPAAETKTEAPKSEPAVAEVQQMVTAAQEQTE
DIPRNSNGRFYSPLVRNIAKEEGVAVSELDSIEGSGAEGRVTKKDVLSYIENRGSGAPAS
APAPSAAPAAKPAAQPQAAAKPAPQAAPVSIGADDEIIEMDRMRKKIADHMVMSKSTSPH
VTSFVEADVTNIWNWRKKVKGEFMKREGENITFTPIFIEAIVKAIKDFPMINVSVDGNNI
IKKKHINIGMAAALPSGNLIVPVIHDADQLNLVGLTKKVNDLANRARNNALKPDDIQGGT
YTVTNVGTFGNVLGTPIINQPQVAIMATGSINKKPAVIETPEGDFIGIRYKMFLSHSYDH
RVVDGALGGMFVKRVADYLEAFDPNRDF
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagttgaactgataatgcccaagatgggcgaaagtgtagcagaagctactatc
ataaaatggctaaaagaagaaggtgacaccattgacatggaagagtctgttcttgaaatc
gctaccgataaagtagacagcgaagtgccttctcctactgaaggagtccttttgaaaaaa
ctttttggtgaagatgatgtagtaaaggttggtgatccaatcgctattatcgaaaccgaa
ggtggtgctagcgaaaatggtgctgctccggctgccgaaaccaaaactgaagctccaaaa
agcgagcctgctgtagctgaagttcagcaaatggtaactgctgctcaagagcaaacagaa
gatattcctcgcaattctaacggtcgtttttactcaccactcgttcgcaatattgcaaaa
gaagaaggtgtagccgttagcgaacttgactcaatagaaggtagcggtgccgaaggtcgc
gttactaaaaaagatgttcttagctatatagaaaaccgtggttcaggtgctccagcatcg
gctccggccccaagtgctgctccggctgctaagcctgctgcacagccacaagctgctgca
aaaccagctcctcaggccgctcctgtttctattggtgctgacgatgaaatcattgagatg
gatcgtatgcgcaagaagattgccgatcacatggtaatgtctaagagcacttctccgcac
gtaacttcttttgtagaagctgacgtaaccaacatttggaactggagaaagaaagtgaaa
ggcgaattcatgaagcgcgaaggcgaaaacatcaccttcactcctattttcatcgaagct
attgtaaaagctattaaggatttcccaatgatcaatgtttctgtagatggaaacaatatc
attaagaaaaagcatatcaatataggtatggccgctgctctgccaagtggaaaccttatc
gttcctgttattcacgatgcagatcagttgaaccttgttggccttaccaaaaaggtaaat
gacttggctaaccgtgcacgtaacaacgcacttaagccagatgatattcaaggtggaaca
tatactgtaaccaacgtaggtacttttggtaatgtattgggtacgccaatcatcaaccag
ccacaagtagctattatggccactggtagtattaataaaaaaccagcagtgattgaaact
ccagaaggagacttcatcggtattagatataaaatgttcttgtcacactcttacgaccac
cgtgtggttgatggagcccttggcggaatgtttgtaaaaagagtagctgattacttagaa
gctttcgatccgaatcgcgatttctaa

DBGET integrated database retrieval system