KEGG   Owenweeksia hongkongensis: Oweho_0996Help
Entry
Oweho_0996        CDS       T01677                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oho  Owenweeksia hongkongensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oweho_0996
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oweho_0996
  Amino acid metabolism
   00310 Lysine degradation
    Oweho_0996
Enzymes [BR:oho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Oweho_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089467..1090813
Genome map
AA seq 448 aa AA seqDB search
MAQVELIMPKMGESVAEATIIKWLKEEGDTIDMEESVLEIATDKVDSEVPSPTEGVLLKK
LFGEDDVVKVGDPIAIIETEGGASENGAAPAAETKTEAPKSEPAVAEVQQMVTAAQEQTE
DIPRNSNGRFYSPLVRNIAKEEGVAVSELDSIEGSGAEGRVTKKDVLSYIENRGSGAPAS
APAPSAAPAAKPAAQPQAAAKPAPQAAPVSIGADDEIIEMDRMRKKIADHMVMSKSTSPH
VTSFVEADVTNIWNWRKKVKGEFMKREGENITFTPIFIEAIVKAIKDFPMINVSVDGNNI
IKKKHINIGMAAALPSGNLIVPVIHDADQLNLVGLTKKVNDLANRARNNALKPDDIQGGT
YTVTNVGTFGNVLGTPIINQPQVAIMATGSINKKPAVIETPEGDFIGIRYKMFLSHSYDH
RVVDGALGGMFVKRVADYLEAFDPNRDF
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagttgaactgataatgcccaagatgggcgaaagtgtagcagaagctactatc
ataaaatggctaaaagaagaaggtgacaccattgacatggaagagtctgttcttgaaatc
gctaccgataaagtagacagcgaagtgccttctcctactgaaggagtccttttgaaaaaa
ctttttggtgaagatgatgtagtaaaggttggtgatccaatcgctattatcgaaaccgaa
ggtggtgctagcgaaaatggtgctgctccggctgccgaaaccaaaactgaagctccaaaa
agcgagcctgctgtagctgaagttcagcaaatggtaactgctgctcaagagcaaacagaa
gatattcctcgcaattctaacggtcgtttttactcaccactcgttcgcaatattgcaaaa
gaagaaggtgtagccgttagcgaacttgactcaatagaaggtagcggtgccgaaggtcgc
gttactaaaaaagatgttcttagctatatagaaaaccgtggttcaggtgctccagcatcg
gctccggccccaagtgctgctccggctgctaagcctgctgcacagccacaagctgctgca
aaaccagctcctcaggccgctcctgtttctattggtgctgacgatgaaatcattgagatg
gatcgtatgcgcaagaagattgccgatcacatggtaatgtctaagagcacttctccgcac
gtaacttcttttgtagaagctgacgtaaccaacatttggaactggagaaagaaagtgaaa
ggcgaattcatgaagcgcgaaggcgaaaacatcaccttcactcctattttcatcgaagct
attgtaaaagctattaaggatttcccaatgatcaatgtttctgtagatggaaacaatatc
attaagaaaaagcatatcaatataggtatggccgctgctctgccaagtggaaaccttatc
gttcctgttattcacgatgcagatcagttgaaccttgttggccttaccaaaaaggtaaat
gacttggctaaccgtgcacgtaacaacgcacttaagccagatgatattcaaggtggaaca
tatactgtaaccaacgtaggtacttttggtaatgtattgggtacgccaatcatcaaccag
ccacaagtagctattatggccactggtagtattaataaaaaaccagcagtgattgaaact
ccagaaggagacttcatcggtattagatataaaatgttcttgtcacactcttacgaccac
cgtgtggttgatggagcccttggcggaatgtttgtaaaaagagtagctgattacttagaa
gctttcgatccgaatcgcgatttctaa

DBGET integrated database retrieval system