KEGG   Owenweeksia hongkongensis: Oweho_1540Help
Entry
Oweho_1540        CDS       T01677                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
oho  Owenweeksia hongkongensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:oho00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667751..1668743
Genome map
AA seq 330 aa AA seqDB search
MLHRPRRLRQSAALREMVAETRLHPSDFIAPLFLIEGKNKKEEIASMPGYFRYSLDLLEA
EVNELWNMGCRSALLFVKVEDDLKDNEGEEALNPDGLMQQGIRMIKEVVPEICLMTDVAL
DPYSEFGHDGIVEDGEIINDESVGFLCEMAISHAQAGADFVAPSDMMDGRIEAMRIALDV
AGFTHTGIMAYSAKYASCFYGPFRDALDSAPVDMADIPKDKKTYQMDPANAVEGVKEAQM
DIDQGADMVMIKPALSYLDVIRRIKDISPVPVTAYHVSGEYAMIKAAAEKGWLNEEEAIV
EVLTSIKRAGADLIATYFVKDIIKLINSKS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttacaccgaccaagaagattacgccaatctgctgcccttagagaaatggtagccgaa
accagattgcacccttccgattttatcgctccattgtttttgatagaaggtaaaaacaag
aaggaagaaattgcctccatgcccggatactttcgctatagcttggatttgcttgaagca
gaagtaaatgaactttggaatatgggctgtcgctcggctttgctttttgtgaaggtagaa
gatgacctgaaagacaatgaaggagaagaagcactaaacccggatggattgatgcaacaa
ggtattcgcatgattaaggaagttgttcctgaaatctgcctgatgacggatgttgccctt
gacccttattctgaatttggccatgatggcattgtagaagatggtgagattatcaatgat
gaatccgtaggttttttatgtgaaatggccattagccatgcacaggccggagctgatttt
gtggcaccaagcgacatgatggatggccgtattgaagccatgcgcattgctttggacgtg
gcgggctttacccatacaggaatcatggcttatagcgccaaatatgcttcatgtttttac
ggccctttccgtgatgctttggattctgcaccggtagatatggcagatattccaaaggat
aaaaagacctaccaaatggatcctgccaatgctgtggaaggtgtgaaagaagctcaaatg
gacatcgatcaaggagccgacatggtgatgataaaacctgctctttcttatttggatgta
atccgcagaataaaagatatttccccagttccggtgacggcttaccatgtaagtggtgaa
tatgccatgataaaagctgccgctgaaaaaggctggttgaatgaagaggaagccatcgtt
gaagttttgacttctatcaaaagagccggagcagatttgatagctacttactttgtgaag
gatattattaagctaataaactcgaaatcctaa

DBGET integrated database retrieval system