KEGG   Owenweeksia hongkongensis: Oweho_1612Help
Entry
Oweho_1612        CDS       T01677                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00010  Glycolysis / Gluconeogenesis
oho00620  Pyruvate metabolism
oho00640  Propanoate metabolism
oho00680  Methane metabolism
oho01100  Metabolic pathways
oho01110  Biosynthesis of secondary metabolites
oho01120  Microbial metabolism in diverse environments
oho01130  Biosynthesis of antibiotics
oho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oweho_1612
   00620 Pyruvate metabolism
    Oweho_1612
   00640 Propanoate metabolism
    Oweho_1612
  Energy metabolism
   00680 Methane metabolism
    Oweho_1612
Enzymes [BR:oho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Oweho_1612
Lipid biosynthesis proteins [BR:oho01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Oweho_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEV32601
UniProt: G8QZH3
Position
complement(1739683..1741581)
Genome map
AA seq 632 aa AA seqDB search
MSYRINSFEEYKSEYQKSIDDPAEFWAGIAENFLWQKKWDTTLEWEFETPKVEWFKGGKL
NITENCLDRHLEKRGNKLALIWEPNDPKERFVRLTYRELHEEVCKYANVLKKHGAKKGDR
IALYMPMIPDLAIAVMACARIGAVHTVVFAGFSASALADRINDCQCKMVLTADGLYRGTK
EIPVKAVVNEALKECTSVETVIVSERTQWNVKMEEGRDFWLHQEVETVDKNCPAEPMDAE
DMLFILYTSGSTGKPKGVVHTCGGYMVYAGYSFANVFQYDESDIYWCTADIGWITGHTYI
LYGPLLNGATTLMFEGVPTYPGPGRFWQVIDKHGVNQFYTAPTAIRALMACGEDHVLSYG
LYSLKVLGSVGEPINQEAWEWYHIHVGKEKSPIVDTWWQTETGGIMISGLGGLSPMNPTH
AGYPLPGIQPVLLDQEGKEITENGVEGYLAIKHPWPSILRTTYGDHERCKNTYFNTYKGY
YFTGDGAKRDENGMYRIIGRVDDVINVSGHRFGTAEIENAINSLDEIVSESAVVGYPHDI
KGQAIYAYVITNKPVETPDKIRAEIIEAVVGEIGKIAKPEKIQFVSGLPKTRSGKIMRRI
LRKIAEGDTSSLGDTSTLLDPDVVDEIKEGAL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcggatcaattcatttgaggaatataaatctgaatatcaaaaaagtatagat
gacccagccgagttttgggctggtatagctgagaattttctttggcaaaagaaatgggat
accaccttagagtgggagtttgaaactccaaaagtggagtggtttaaaggtggtaagcta
aatatcacggaaaactgtctggatcgccatttagaaaaacgtggcaacaaactggctctt
atctgggagccaaatgaccctaaagaaagatttgttcgccttacttaccgggagcttcat
gaagaagtatgcaaatacgccaatgtgctgaaaaagcatggtgcaaaaaagggtgatcga
attgcgctctatatgcccatgattcctgatttggctatagccgtaatggcttgcgccaga
ataggggctgtgcatacggtggtgtttgcaggtttttcggctagtgctttggctgatcgc
atcaatgattgtcaatgcaaaatggtgcttactgcagatggattgtatcgtggcacgaaa
gaaattcccgtaaaggctgtggtgaatgaggcgctaaaagaatgtacttctgtagaaacg
gtgatcgtttctgaacgcacccagtggaatgtgaaaatggaagaaggcagggatttttgg
cttcaccaggaagttgaaactgtagataaaaattgccctgccgagcctatggatgctgag
gatatgttatttattttatacacttccggaagcacaggaaagccaaagggagtggtgcat
acctgtggtggctatatggtatatgccggatatagctttgctaatgtttttcaatatgat
gaaagcgatatttattggtgtacggctgatatcggctggattaccgggcacacatatatt
ctttatggcccacttttgaatggcgcaactactttaatgtttgaaggtgttcctacttat
cctggcccaggtcgtttttggcaggtaatagacaagcatggtgtgaatcagttttacaca
gcacctacagcaatcagggcgcttatggcctgtggtgaagatcatgttttgagctatggc
ctatattcactcaaagtgctgggaagcgtgggtgagcctatcaatcaggaagcatgggaa
tggtaccacattcatgtgggtaaagaaaagtctcccattgtagacacatggtggcaaacc
gaaacaggtggaattatgatttcaggattaggcggtctttcaccaatgaatcctactcat
gcgggctaccccttgccgggaatacagccggtgcttttagatcaggaagggaaagagatt
acagaaaatggagtggaaggttatttggctataaagcatccgtggcccagtattttgcgc
accacctatggtgatcatgagcgttgcaaaaacacatattttaatacctataaaggatac
tactttacgggtgatggagccaagcgcgatgaaaatggaatgtatagaataattggtcgt
gtggatgatgtaatcaacgtaagtggccaccgatttggcactgctgaaattgaaaatgcc
attaattcattagatgaaatagtctcggaaagtgcggttgtgggttatccacatgatata
aaaggccaagccatttatgcttatgtaattaccaataaacctgtagaaacccctgataaa
ataagggctgaaataattgaagctgtggtaggtgaaattggaaaaatagctaagcctgaa
aaaattcagtttgtgagtggtttgcccaaaacccgttcgggtaaaattatgcgaagaatt
ttaagaaaaattgcagaaggtgatacttcaagccttggtgatacttctacattgctcgac
cctgatgtggtggatgagataaaagagggtgcgttgtaa

DBGET integrated database retrieval system