KEGG   Owenweeksia hongkongensis: Oweho_1693Help
Entry
Oweho_1693        CDS       T01677                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
oho  Owenweeksia hongkongensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oweho_1693
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Oweho_1693
Enzymes [BR:oho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Oweho_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1839870..1840655
Genome map
AA seq 261 aa AA seqDB search
MAEHCDKKKRVVVKVGTNVMTNKDNRIVGPILKSLVHQIAKLYEEDVLTVLVSSGSAIAG
KEVLGDSEIQDPTTRRQVFSAVGQPRMMRHYYSIFHDYGMRCAQVLATKRDFAPGKHRDN
MINCYEALLSEGIIPIANEDDAVSLTMSMFSDNDELASLVAELIDADMLILLTDTDGLFT
GHPDHDDSKIIRHVQIDQDVEQYIQESEKGEGEGRGGMESKLGVAKSTAAKDIPTYIANG
KRENVIVDIVQGKEVGTRFTA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacattgcgacaaaaagaaaagagtagtggtaaaagttggtaccaatgtaatg
accaacaaggataatcgcattgtaggccccattttgaaaagtttggtacatcaaattgct
aagctttatgaagaggatgtacttacagttttagtttcctcaggttccgctattgcggga
aaagaagtgttgggtgacagcgaaattcaagatcctaccacacgtagacaggtattttct
gctgtgggtcaaccgcgaatgatgcgccattactacagtatttttcatgattatggaatg
cgctgtgcacaagtacttgccaccaagcgtgactttgcgccaggtaagcaccgtgacaat
atgataaactgctatgaagcacttttaagcgaagggataattcctattgcaaatgaagat
gatgccgtttcgcttaccatgtctatgttttcagacaatgacgagttggccagcctggtg
gcggaattgattgatgcagatatgctcatcctattgacggacacagatgggctttttacc
ggtcatcccgatcatgatgattcaaaaattatccgtcatgtacaaattgaccaagatgta
gaacaatacattcaggaaagtgaaaaaggcgaaggcgaaggccgtggtggaatggagagc
aaactaggtgttgcaaaaagtaccgctgccaaagacattcctacctatatagccaacggt
aaacgcgaaaatgtaattgtggatatagtgcaaggcaaagaagtgggaacccgatttaca
gcatag

DBGET integrated database retrieval system