KEGG   Owenweeksia hongkongensis: Oweho_1747Help
Entry
Oweho_1747        CDS       T01677                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
oho  Owenweeksia hongkongensis
Brite
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Oweho_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1899432..1900577
Genome map
AA seq 381 aa AA seqDB search
MQQKHSSTIWKLFLLAILSIGLYQCKKPEDQSSPVMFGTPQPLEIPKGFPRTNVPADNPQ
TIEGVELGRHLFYDKRLSADLTQSCASCHAQHRAFSDVTLDPTSTGVDGIKGRRNSMALF
NLAFQEKFFWDGRAQSLEEQSLHPIEDPLELNVKLETVIARLEADTAYPEMFAAAFGDNK
ISKKRIGKAIAQFERTMISANSEFDKVKRISGNIDAPFIEDASTPGSKNNGWLLFKGTTG
DCFHCHSIEADGAFLGGSFGVNNQFRNNGLKMKYRGDLGRQGVTNEPSDFGKFKVPSVRN
SERTAPFMHDGSVPSLDSVIRFYSFGGFSNGNTDPQMDFAGDAKGTRNLSEEQIDDLEEF
LKTLTDWEFLEDPRFSDPFAE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaaacattcttcaacaatctggaagcttttccttttggcaattctaagcata
ggactataccaatgtaaaaaaccagaagaccaaagctctccagtaatgtttggcactcct
cagccattagagattcccaaaggttttcccagaacaaacgttcccgctgataatcctcaa
acaattgaaggtgtagagctcggccggcatttgttttatgacaaaagattatcagctgac
cttacccagagctgtgcttcttgccatgctcagcatcgcgctttttcggatgtaacactt
gacccgacctccacaggagtggatggaatcaaaggaagacgaaattccatggctttattc
aacctggcttttcaggagaaatttttttgggatggtcgtgcccaaagtttagaagagcag
tctttacatcctattgaagatccgctggaattgaatgtgaaattggaaaccgtaatagcc
cgactggaagctgacactgcttatccagaaatgtttgcagccgcttttggtgataataaa
atatccaagaaaagaattggaaaagctattgcgcaatttgagcgaactatgatttcagcc
aatagcgagtttgacaaagtaaaacgtattagtggaaatatagacgccccatttatagaa
gatgcttctacccctggctcaaaaaacaatgggtggctattatttaaaggtacaactggc
gactgttttcattgccattctattgaggcagatggtgcgtttcttggcggtagttttggt
gtcaataatcagtttagaaataacggattaaaaatgaagtaccgaggtgatcttggaaga
cagggggtgacaaacgaaccttcagactttggcaaattcaaggtgccaagtgtaagaaac
tccgagcgaactgccccattcatgcatgatggaagcgttcctagtcttgacagtgtgatc
cgcttttacagttttggaggcttctctaatggaaacacagacccccaaatggattttgct
ggtgatgcaaaaggaacacgaaacctttcggaggagcaaattgacgatttagaagaattt
ctaaaaacccttaccgactgggaatttcttgaagacccacgtttttctgatccttttgct
gaataa

DBGET integrated database retrieval system