KEGG   Owenweeksia hongkongensis: Oweho_1765Help
Entry
Oweho_1765        CDS       T01677                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00010  Glycolysis / Gluconeogenesis
oho00020  Citrate cycle (TCA cycle)
oho00620  Pyruvate metabolism
oho01100  Metabolic pathways
oho01110  Biosynthesis of secondary metabolites
oho01120  Microbial metabolism in diverse environments
oho01130  Biosynthesis of antibiotics
oho01200  Carbon metabolism
Module
oho_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oweho_1765
   00020 Citrate cycle (TCA cycle)
    Oweho_1765
   00620 Pyruvate metabolism
    Oweho_1765
Enzymes [BR:oho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Oweho_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C DUF1510 DDHD RNA_pol_Rpc4 DUF4611 DUF2118 U1snRNP70_N RR_TM4-6 CPSF100_C SAPS CDC45 RP-C_C
Motif
Other DBs
NCBI-ProteinID: AEV32746
UniProt: G8R131
Position
complement(1920291..1921559)
Genome map
AA seq 422 aa AA seqDB search
MAEVVTMPRLSDTMEEGTVAKWHKKVGDKVSEGDLLAEIETDKATMDFESFQEGVLLHIG
IEEGSTAPVDSILAILGEKGEDISDILEGKSSSESEKDVKEESTEEKKEGKDEDKKEDKS
EKKEESSSESKSKESTSDSSNDDRIKASPLAKKMAEDKGIDLRSVKGTGEGGRIVKQDID
NYKESAAPAAQTELGKESYEDVPVSQMRKVIAKRLAESKFTAPHFYLTLDIDMDAAMEAR
KSINLISETKISFNDLVVKAVAASLKKHPAVNSSWMGDKIRENHHVHIGVAVAVEDGLLV
PVIRHADQKGLATINGEVKALAEKAKNKKLQPAEWEGNTFTISNLGMFGIEEFTAIVNPP
DSCILAVGGIKQVPVVKNGAVVPGNVMKVTLSCDHRVVDGATGAGFLQTFKGLLENPMGL
IL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagtcactatgccccgtcttagcgataccatggaagaaggtaccgtagct
aaatggcataaaaaagtaggagataaagtaagcgaaggcgacttattagctgaaatcgaa
actgacaaagccactatggactttgaatcatttcaggaaggtgtccttttacatataggt
atcgaagaaggaagtaccgctccagtagattccattcttgccattttgggtgagaaagga
gaagatattagcgatattcttgaaggcaagagttcttctgaatctgaaaaagacgtgaag
gaagaaagtacagaggagaagaaagaaggtaaggacgaggacaagaaggaagataaatca
gagaaaaaggaagaatcttcatctgagtctaaatcaaaagagtctacctccgattcttca
aacgatgatcgcatcaaggcttcaccacttgctaagaaaatggccgaagacaaaggaatt
gatctaagatcagtgaaaggaactggtgaaggcggtcgaattgtaaagcaagacatagat
aattataaggaatcagcagctccggcagcacaaaccgagcttggtaaagaaagttatgag
gatgttcctgtttcgcaaatgcgaaaagtaattgctaagcgtttggctgaatctaaattc
acagcaccacatttctatcttactttggatattgatatggatgctgcaatggaggcgcgt
aagtcgatcaaccttatttctgaaactaaaattagcttcaatgatttggtagtaaaagcg
gttgctgcttctttgaaaaagcatccggctgtaaattcaagttggatgggtgataagatt
cgcgagaatcatcatgttcatattggagttgcagttgcagtggaagatggacttttagtt
cctgtgattcgccatgctgatcaaaaaggattggcaacaatcaacggagaagtgaaagct
ttggcagaaaaagccaaaaacaagaagcttcaacctgcagaatgggaaggaaacaccttt
accatttccaacctaggtatgtttggtatagaagaatttaccgcaatcgttaatccgcca
gacagctgtattttggctgttggaggaattaagcaggtgccggtggtaaaaaatggagcc
gttgtacctggtaatgtaatgaaggttaccctaagttgcgatcaccgtgtggtggatgga
gcaactggcgcaggattcttgcaaacgttcaaaggattacttgaaaacccaatggggctc
attttgtaa

DBGET integrated database retrieval system