KEGG   Owenweeksia hongkongensis: Oweho_1914Help
Entry
Oweho_1914        CDS       T01677                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
oho  Owenweeksia hongkongensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oho00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Oweho_1914
Enzymes [BR:oho01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Oweho_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2104619..2105197)
Genome map
AA seq 192 aa AA seqDB search
MIYYIEGKLTEVTPTYAVLDCAGVGYLVNITLSTYSNICAKPSVKLFTHAIYKEDSQTLF
GFNAKSERDIFIQLISVSGVGGNTARVILSSLSSEEVISAISSENVRLLQSIKGIGAKTA
QRIIIDLKDKVTGIETSITTMGAPAGVKVEAASALEVLGYTPKQTERLLVQLTGETPDAG
VEEIIKQALKRL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatatattatatagaagggaaattgacagaggtaacaccaacctatgcggtgttggac
tgtgccggtgtgggatatttagtcaatattaccctatctacatattccaatatttgtgcc
aaacctagcgtgaagttatttactcatgccatatacaaagaagactctcaaacactattt
gggtttaatgctaaatcagaaagagacatttttattcaactgatttcggtgagtggagtg
ggaggtaatacggctagagtcattttaagtagcctttcttctgaggaagtgattagcgca
atttcatctgagaatgtacgtttattacaatccataaaaggcattggtgccaaaacagcc
cagcgaattatcattgacctaaaagataaggtaacaggtattgaaacttcgattaccaca
atgggggcaccggccggtgtaaaagtagaagcagcttctgctttggaagtactagggtat
actccaaaacaaacagaaagactcttggtgcagctaacgggtgaaacgcctgatgctgga
gtggaagagatcataaagcaagcgttgaagagattataa

DBGET integrated database retrieval system