KEGG   Owenweeksia hongkongensis: Oweho_2024Help
Entry
Oweho_2024        CDS       T01677                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00020  Citrate cycle (TCA cycle)
oho00310  Lysine degradation
oho01100  Metabolic pathways
oho01110  Biosynthesis of secondary metabolites
oho01120  Microbial metabolism in diverse environments
oho01130  Biosynthesis of antibiotics
oho01200  Carbon metabolism
Module
oho_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oho_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oweho_2024
  Amino acid metabolism
   00310 Lysine degradation
    Oweho_2024
Enzymes [BR:oho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Oweho_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AEV33001
UniProt: G8R307
Position
2225461..2226693
Genome map
AA seq 410 aa AA seqDB search
MSVEIKVPSPGESVSEVEIASWLVEDGDYVEKDQEIVELDSDKATLAMPAEESGIISISV
EEGEEVEVGQVIGTIDTSAAKPEGSGDDSKKEDKPKADAPKEEAKAEKAPAKKEETYASG
SASPAARKILDEKGIDAKAVEGTGRDGRITRDDAVKAEASMGTSTGAARPSDRKKMSSLR
RKLAKRLVSVKNETAMLTTFNEVDMKPIFDLRSEYKEDFKEKHGVGLGFMSFFTLAVTRA
LKEFPQVNSMIDGDDLITFDYADISIAVSGPKGLMVPVIRNAENLSFAGVEKEVKRLAIR
VREGQITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIVERPVAIDGKVEIR
PIMYVALSYDHRVIDGRESVGFLVAVKEALENPQELLMGGDNVVKKALEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagaaattaaagttccatcacctggtgaatccgtatcagaagtagaaatcgct
tcgtggttagtagaagatggcgactacgtagaaaaagaccaagaaattgtagagcttgac
tctgacaaagctacccttgccatgccagctgaagaatctggtattatttctatatctgta
gaagaaggcgaagaagtggaagtgggccaggtaattggaaccattgacactagtgcagcc
aagccagaaggaagtggtgatgacagtaaaaaagaggacaagccaaaagcagatgctcca
aaagaggaagctaaagctgaaaaagctcctgccaaaaaagaagaaacttatgcttctggt
agcgcttcgcccgcagctcgcaaaattcttgacgaaaagggaattgacgcaaaagctgtg
gaaggtactggccgtgatggccgaattacccgcgatgacgctgtaaaagctgaagcttct
atggggacttctactggtgccgctcgtccttctgatcgcaaaaagatgagctccttgcgc
agaaagcttgctaagcgtttggtatctgtaaaaaatgaaacggctatgcttaccactttt
aatgaagtggatatgaagccaatctttgatcttagatcagagtacaaagaagactttaaa
gagaagcatggtgtaggccttggttttatgtcattctttacccttgcggtaacacgtgct
ttgaaagaatttcctcaggtaaactcaatgattgatggtgatgatttgatcactttcgat
tacgcagatattagcatcgcggtaagtggaccaaaaggacttatggttcctgtgattcgc
aatgccgaaaacctaagctttgctggtgtagaaaaagaagtgaagcgtttggcgatccgt
gttcgtgaaggtcaaattaccgttgatgaaatgactggtggcacctttaccattaccaat
ggtggtgtatttggctctatgctttctacccctattatcaaccctccacagagtgctatc
cttggaatgcacaatatcgttgagcgtccggtagctattgatggaaaagtagaaattcgt
ccgattatgtatgtggctctttcttatgaccaccgtgtaattgatggccgtgagtctgta
ggtttccttgtagctgtaaaagaagctttggaaaacccacaagaacttttgatgggtggt
gacaatgtggtaaaaaaagcccttgagttgtag

DBGET integrated database retrieval system