KEGG   Owenweeksia hongkongensis: Oweho_2139Help
Entry
Oweho_2139        CDS       T01677                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
oho  Owenweeksia hongkongensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Oweho_2139
Enzymes [BR:oho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Oweho_2139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2390916..2391488
Genome map
AA seq 190 aa AA seqDB search
MAKQGKLLIFSAPSGSGKTTLVRFLLSLDLGIEFSISATSRAPRGEEVDGKDYYFLSEED
FKKRVIHGDFLEWEEVYSGTMYGTLRSEVERIWEKGNAVIFDMDVVGGLNLKSLYGDAAL
SIFVMPPSMEELEKRLRGRQTDSEDKIRQRLAKARKEIGRSDRFDHILLNNDLATAKKEA
ESLVRLFLGK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacagggtaagctattaatattttccgcgcccagcggatcgggaaaaaccact
ttggtgaggtttcttttgagccttgatctcggaatagaattcagcatttcggcaaccagc
cgtgcgccacgtggcgaagaagtggatggcaaggactactactttctttcggaagaagat
tttaaaaagcgcgtgattcacggagattttttggagtgggaagaagtgtatagcggaacc
atgtatggcacgcttcgctcggaagtggagcgcatttgggaaaaaggaaatgctgtgatt
tttgatatggacgtggtgggcggactcaacctgaaaagcctgtatggcgatgctgcactt
tctatttttgtgatgcccccaagcatggaagaattggaaaagcgcttacgcggaagacaa
accgatagcgaggataaaataagacagcgcctggccaaagcccgaaaagaaattggtcgc
tccgatcgttttgatcacattttgctgaacaatgatttggctacagccaaaaaggaagcc
gaaagtttagtgcgtttatttttagggaaatga

DBGET integrated database retrieval system