KEGG   Owenweeksia hongkongensis: Oweho_2435Help
Entry
Oweho_2435        CDS       T01677                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
oho  Owenweeksia hongkongensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:oho00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2714137..2715162
Genome map
AA seq 341 aa AA seqDB search
MTKQEKISAFDPNGLATSDQLFGLPFSYEESETVVIPIPWEVTVSYSAGTASGPKAIAEA
SLQVDLYDAFLKDAWKRGIFMMEQDHKWEATSNQYRHLAEKHIDNLESERVDEELLHSVN
GACAGMVARVKELCANALNDGKRVALLGGDHSTPLGYMQALAERHADFAILQIDAHADLR
DAYEGFEYSHASIMFNALKIPQVSKLVQIGIRDYCEAENDIIEQSKGRVTTYFDRDLKAA
RFNGKTWKEQCEEIVAQLPEKVYLSFDIDGLDPKLCPNTGTPVAGGFEVEEVLFLLETLV
KSGKKIIGLDLNEVAPGEDEWDANVGARLLYRLCNIMAVGG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaagaaaaaatttcagcctttgatcccaacggattagcaactagtgaccag
ctttttggcttgccgtttagctatgaagagagtgaaactgtagtcattccgattccatgg
gaagttaccgtgagctatagtgctggaactgcatcggggccaaaagccattgcagaggct
tcgctacaggtagatttgtacgatgcttttttgaaggatgcctggaagcgcggaattttc
atgatggagcaagatcataaatgggaagccacgagcaatcagtatcgtcatttggctgaa
aagcacattgacaatttagaaagtgaaagggtagatgaagaacttttgcatagtgtgaat
ggagcgtgtgcaggaatggtggcgcgtgtgaaggagctgtgtgcgaatgccctgaatgat
ggaaaaagggttgcgcttttgggaggtgatcatagcacgccattaggatacatgcaagct
ttagccgaaaggcatgccgacttcgcgatactgcaaattgatgcccacgcagatctacga
gatgcttatgaaggctttgagtattctcatgcttccataatgtttaatgcgcttaaaata
cctcaggtaagtaaactggtgcaaattggtattagagattattgcgaggcagagaacgac
atcattgaacagtcaaaaggtcgcgttactacatattttgaccgtgatttaaaagccgct
cgatttaacgggaaaacgtggaaagagcagtgcgaggaaatcgtggcgcagcttcctgaa
aaggtgtatttgagttttgatattgatggcttggatcctaagctttgtccaaatacagga
acacccgtagcaggtggttttgaagtagaagaggtgctttttcttttggaaactttagtg
aaatccggtaagaaaataatcggactggaccttaatgaagtagctcccggagaggacgaa
tgggatgctaacgtaggggcgagattgctctacaggctttgtaatattatggcagtgggg
ggttga

DBGET integrated database retrieval system