KEGG   Owenweeksia hongkongensis: Oweho_2573Help
Entry
Oweho_2573        CDS       T01677                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
oho  Owenweeksia hongkongensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oho00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:oho00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:oho02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2861952..2863871)
Genome map
AA seq 639 aa AA seqDB search
MDNLIKAIILCTLLVIGLAAQAQNTFAHSGGIDSSYFDPSLAPFYHGVASGDPLQDKVII
WTRVTPTKDTIIPVKWYIATDTAFTNIVNSGETTTDYTKDYTVKVDVDLLEPGITYFYYF
QALGANSLIGRTRTLPTNTNHLRLAVGSCSNYQMGYFNAYQRLAERNDLDAIIHLGDYIY
EYATYDYGWTSAVGRTHKPDHELNSMDDYRIRHAYYKLDPSLRAAHQQHPFIVVWDDHEI
VNDASTNGVSKLYNHDPAEDGDYETRKFNAVTAYLEWMPIREQKNETSGVRIYREFNFGN
LMDLYMVDTRLEERSLQVHSAGDPLVNDTTRTILGKTQSDWLFGEMENSTAQWQVIGNQV
MFSQLNEAFKLDSWVGYPYEREKIQNKFLGLNTKNIVILTGDTHRSWAFDLAEEPFGQGT
YAPNTGTGTFGVELCTPSLASPNMDEGSSTMADVFAEQAALSAENSHLRYVDLSQHGYFI
LDLTPLKVQADYFYGETQTISSTEQFAKGLFSYNEEGFLREALAPAPAKIGNFPAAPQKP
LAYSVGMDEVKTANEVLFVGAYPNPVWDIVNVGLSVNESKAVELQLLSVEGKVISNNEYT
LNPGHHKIELKMSDFPKGIYFLQISSSGKALYQKRLVKK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggataacctaattaaagcaatcatactgtgtacccttctggtaataggtctggcggca
caagcacaaaatacctttgcacatagcggaggtattgattccagctattttgatccttca
ttggcgcccttttatcacggggtggccagtggagatcctcttcaggataaagtaattatt
tggacccgcgtaacaccaaccaaggatacaatcattcctgtaaagtggtatatcgccacc
gacaccgcttttaccaacattgtaaattctggtgaaaccactactgactataccaaagat
tacactgtaaaagtagatgtagatttattggagcccggcatcacctacttctactacttt
caggcgcttggcgcaaatagccttattggccgtacacgcactctgcctaccaataccaat
cacttgagattggcggtaggttcatgctcaaactaccaaatgggatattttaatgcttac
caacgccttgctgaacgaaatgacttggacgccattatccacttaggtgattatatttat
gaatatgcaacctatgactatggctggaccagtgccgtaggacgcacccataaacccgat
catgaattgaacagcatggatgactatcgcattcgccatgcctattataaacttgatcca
agtttaagagcagcgcatcagcagcacccttttattgtagtgtgggatgatcacgaaata
gtaaatgatgccagtaccaatggtgtatccaagctttacaaccacgatcctgcagaagac
ggtgattatgaaacgcgcaagtttaatgcagtaacggcttatttggaatggatgcccatc
cgtgagcagaaaaatgaaacttcaggagtgcgaatttatcgcgaattcaactttggaaac
ttgatggacttgtacatggtagatacccgtttagaagaaagatctctgcaagtacactct
gctggtgatccattggtaaatgatactacacgtaccattttgggtaaaacccaaagcgac
tggttgtttggcgaaatggaaaactctactgcacaatggcaagtaattggaaatcaggtg
atgttttctcagcttaatgaagctttcaaactagactcctgggtaggctacccttatgag
cgtgaaaaaattcaaaacaaatttctagggctcaataccaagaatatagtaatccttact
ggtgatacgcatcgctcttgggcctttgatttggcagaggaaccttttggacaaggtacc
tatgctccaaataccggaacaggaacctttggtgtggagctttgcacgccaagtttggca
tcaccaaatatggatgagggaagcagcactatggccgatgtatttgctgaacaagcagct
ttgagcgcagagaatagtcatcttcggtatgttgatttatctcagcacggatactttatt
ttggacctaactccactcaaagttcaggctgattatttttatggtgaaacccaaaccatt
agcagtactgagcagtttgcaaaaggattattttcatacaatgaagaaggttttttaaga
gaggcactagctccggctccagccaaaattggaaattttccagctgcaccgcaaaaacca
ttggcgtattcagtaggaatggatgaagtaaaaactgctaatgaagttctctttgtaggc
gcttatccgaaccccgtgtgggatatagtgaacgtaggcttgagtgtgaatgaaagcaaa
gctgtagagctacaacttttatcagttgaaggaaaagtaatttctaacaatgaatacact
ctgaatcctggccatcacaaaattgagcttaagatgagtgattttccaaagggaatttac
tttttgcagatttcctcttcagggaaagcgctttaccaaaagagattggtgaagaagtaa

DBGET integrated database retrieval system