KEGG   Owenweeksia hongkongensis: Oweho_2634Help
Entry
Oweho_2634        CDS       T01677                                 

Definition
glutamine phosphoribosylpyrophosphate amidotransferase
Orthology
K00764  
amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
oho  Owenweeksia hongkongensis
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:oho00230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:oho00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2941181..2943079)
Genome map
AA seq 632 aa AA seqDB search
MSDAIKHECGIALVRLKKPLDFYLEKYGTALYGVNKMYLLMEKQHNRGQDGAGLANIKLD
MPPGSRYISRHRSNDKTPIQDLFQHINKRISDGVGENRERLQDPEWLKQNLPYVGELYLG
HLRYGTYGGNSVEQCHPFLRQNNWVTRNLILAGNFNMTNVDELFTQLVDLGQHPKEKADT
VTILEKIGHFLDEQNEKLYRKFKKEGLEKRDITDLIAKDLSIKKILRKSAKHWDGGYAMA
GLFGHGDAFVLRDPSGIRPAYFYDDDEVTVVASERPVIQTAFNVPIESIKEIDPGHALII
KKSGHARLEMIKEPLERKACSFERIYFSRGNDADIYRERIDLGNRVCPAILDEVDHDLKN
TVFSFIPNTAEISFYGMVKGMESYLNEVKRDKILKHEGTLEGDKLQELLEIRPRVEKSIW
KDVKMRTFITEDSSRDDLVSHVYDITYETVKPTDNLVVIDDSIVRGTTLKQSILKILDRL
NPKKIVVVSSAPQIRYPDCYGIDMAKLGDFIAFRAAIALLKERGLDNVIDNVYEKCLAQA
ELPESEIQNFVKEIYEPFSPQEVSDKIAEILTPPEVRAEVKIIFQTIEDLHASCPNNLGD
WYFTGDFPTAGGMRVVNKAFLNFYEGKNVRAY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgccattaaacacgagtgcggaatagcacttgtccggttaaaaaaaccacta
gacttttaccttgaaaagtacggtactgccctctatggggttaacaaaatgtacctgctc
atggagaagcagcacaaccgtgggcaagatggcgcaggccttgccaacattaagctggat
atgcctcctggtagccgctacatcagccgccaccgctccaatgataaaactcctattcag
gatctttttcagcacatcaacaaaagaataagtgatggtgtgggcgaaaatcgtgagcgc
ctgcaggatccggaatggcttaaacaaaatcttccctacgtaggagaactttacttgggt
caccttcgatacggtacctatggcggaaactctgtagagcaatgtcacccatttttgcgt
caaaacaactgggtaacccgtaaccttatccttgccggaaacttcaacatgactaatgtt
gatgagctttttacacaattagtggacttgggtcagcacccaaaagaaaaagcggatacc
gtgactattcttgaaaaaataggtcactttttggatgagcaaaatgagaagctttaccgc
aagtttaaaaaagaaggtcttgaaaaacgcgatatcacagacctcatagcgaaagattta
agcattaaaaaaatattgcgcaaaagcgctaagcactgggatggtgggtatgcaatggcc
ggattgtttggtcatggtgatgcttttgttcttcgtgatccttctggcattcgccccgca
tatttttatgatgatgacgaagtaaccgtagtagcttctgagcgcccggttattcaaacg
gcattcaacgttcctattgagtccatcaaagaaattgaccctggtcatgctttgatcatc
aaaaagagtgggcatgcccgtctggaaatgatcaaagaaccattggaaagaaaagcatgc
tcttttgagcgcatctatttttcccgtggcaatgatgctgacatttatcgcgaacgtatc
gatcttggaaatagagtttgccccgccattttggacgaggtagaccacgaccttaaaaac
actgtgttctcttttatccccaacaccgctgaaatttcgttttatggaatggtaaaaggg
atggaatcttacctcaacgaagtgaagcgagacaagattttgaaacacgaaggaacctta
gaaggtgataaacttcaggagcttttggaaatccgtccacgtgtggagaaatccatctgg
aaggatgtgaagatgcgcacctttattaccgaggatagcagccgcgatgatttggtaagc
cacgtttacgacatcacttatgaaacggtaaaacctaccgacaaccttgtggtgattgac
gatagtatcgtaagaggaacaactttgaaacaaagtattcttaagattttggatcgtctt
aatcctaagaaaattgtggtggtttcttctgctccgcaaattcgctacccagactgctac
ggtattgacatggctaagcttggtgattttatcgctttccgtgctgccattgcattgcta
aaagaaagagggttagacaatgtgattgacaacgtttacgaaaagtgtttagcgcaagcg
gaacttccagaaagtgaaattcagaattttgtaaaagaaatttatgagcctttcagccct
caggaagtttcagataaaattgctgaaatacttactccaccagaagtgcgagctgaagta
aaaataatcttccaaactattgaagacctgcacgcttcgtgcccaaataacttaggagac
tggtactttaccggagatttcccaactgctgggggaatgcgcgtggtaaacaaggccttc
cttaacttttatgaaggaaagaatgtgagagcttactaa

DBGET integrated database retrieval system