KEGG   Owenweeksia hongkongensis: Oweho_2634Help
Entry
Oweho_2634        CDS       T01677                                 

Definition
(GenBank) glutamine phosphoribosylpyrophosphate amidotransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00230  Purine metabolism
oho00250  Alanine, aspartate and glutamate metabolism
oho01100  Metabolic pathways
oho01110  Biosynthesis of secondary metabolites
oho01130  Biosynthesis of antibiotics
Module
oho_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Oweho_2634
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Oweho_2634
Enzymes [BR:oho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     Oweho_2634
Peptidases [BR:oho01002]
 Cysteine Peptidases
  Family C44
   Oweho_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 GATase_4 GATase_2 PRTase_2
Motif
Other DBs
NCBI-ProteinID: AEV33598
UniProt: G8R8Z0
Position
complement(2941181..2943079)
Genome map
AA seq 632 aa AA seqDB search
MSDAIKHECGIALVRLKKPLDFYLEKYGTALYGVNKMYLLMEKQHNRGQDGAGLANIKLD
MPPGSRYISRHRSNDKTPIQDLFQHINKRISDGVGENRERLQDPEWLKQNLPYVGELYLG
HLRYGTYGGNSVEQCHPFLRQNNWVTRNLILAGNFNMTNVDELFTQLVDLGQHPKEKADT
VTILEKIGHFLDEQNEKLYRKFKKEGLEKRDITDLIAKDLSIKKILRKSAKHWDGGYAMA
GLFGHGDAFVLRDPSGIRPAYFYDDDEVTVVASERPVIQTAFNVPIESIKEIDPGHALII
KKSGHARLEMIKEPLERKACSFERIYFSRGNDADIYRERIDLGNRVCPAILDEVDHDLKN
TVFSFIPNTAEISFYGMVKGMESYLNEVKRDKILKHEGTLEGDKLQELLEIRPRVEKSIW
KDVKMRTFITEDSSRDDLVSHVYDITYETVKPTDNLVVIDDSIVRGTTLKQSILKILDRL
NPKKIVVVSSAPQIRYPDCYGIDMAKLGDFIAFRAAIALLKERGLDNVIDNVYEKCLAQA
ELPESEIQNFVKEIYEPFSPQEVSDKIAEILTPPEVRAEVKIIFQTIEDLHASCPNNLGD
WYFTGDFPTAGGMRVVNKAFLNFYEGKNVRAY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgccattaaacacgagtgcggaatagcacttgtccggttaaaaaaaccacta
gacttttaccttgaaaagtacggtactgccctctatggggttaacaaaatgtacctgctc
atggagaagcagcacaaccgtgggcaagatggcgcaggccttgccaacattaagctggat
atgcctcctggtagccgctacatcagccgccaccgctccaatgataaaactcctattcag
gatctttttcagcacatcaacaaaagaataagtgatggtgtgggcgaaaatcgtgagcgc
ctgcaggatccggaatggcttaaacaaaatcttccctacgtaggagaactttacttgggt
caccttcgatacggtacctatggcggaaactctgtagagcaatgtcacccatttttgcgt
caaaacaactgggtaacccgtaaccttatccttgccggaaacttcaacatgactaatgtt
gatgagctttttacacaattagtggacttgggtcagcacccaaaagaaaaagcggatacc
gtgactattcttgaaaaaataggtcactttttggatgagcaaaatgagaagctttaccgc
aagtttaaaaaagaaggtcttgaaaaacgcgatatcacagacctcatagcgaaagattta
agcattaaaaaaatattgcgcaaaagcgctaagcactgggatggtgggtatgcaatggcc
ggattgtttggtcatggtgatgcttttgttcttcgtgatccttctggcattcgccccgca
tatttttatgatgatgacgaagtaaccgtagtagcttctgagcgcccggttattcaaacg
gcattcaacgttcctattgagtccatcaaagaaattgaccctggtcatgctttgatcatc
aaaaagagtgggcatgcccgtctggaaatgatcaaagaaccattggaaagaaaagcatgc
tcttttgagcgcatctatttttcccgtggcaatgatgctgacatttatcgcgaacgtatc
gatcttggaaatagagtttgccccgccattttggacgaggtagaccacgaccttaaaaac
actgtgttctcttttatccccaacaccgctgaaatttcgttttatggaatggtaaaaggg
atggaatcttacctcaacgaagtgaagcgagacaagattttgaaacacgaaggaacctta
gaaggtgataaacttcaggagcttttggaaatccgtccacgtgtggagaaatccatctgg
aaggatgtgaagatgcgcacctttattaccgaggatagcagccgcgatgatttggtaagc
cacgtttacgacatcacttatgaaacggtaaaacctaccgacaaccttgtggtgattgac
gatagtatcgtaagaggaacaactttgaaacaaagtattcttaagattttggatcgtctt
aatcctaagaaaattgtggtggtttcttctgctccgcaaattcgctacccagactgctac
ggtattgacatggctaagcttggtgattttatcgctttccgtgctgccattgcattgcta
aaagaaagagggttagacaatgtgattgacaacgtttacgaaaagtgtttagcgcaagcg
gaacttccagaaagtgaaattcagaattttgtaaaagaaatttatgagcctttcagccct
caggaagtttcagataaaattgctgaaatacttactccaccagaagtgcgagctgaagta
aaaataatcttccaaactattgaagacctgcacgcttcgtgcccaaataacttaggagac
tggtactttaccggagatttcccaactgctgggggaatgcgcgtggtaaacaaggccttc
cttaacttttatgaaggaaagaatgtgagagcttactaa

DBGET integrated database retrieval system