KEGG   Owenweeksia hongkongensis: Oweho_3104Help
Entry
Oweho_3104        CDS       T01677                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
oho  Owenweeksia hongkongensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oweho_3104
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oweho_3104
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oweho_3104
Enzymes [BR:oho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oweho_3104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3476023..3476814)
Genome map
AA seq 263 aa AA seqDB search
MNTLKSKNKVQTLFEQKQKDILTIYFTAGFPKLNDTPKILNGLEAAGVDIIEIGIPYSDP
LADGPVIQNSSTLALNNGMTLAKLFEQLEHVTIEAPIVLMGYLNPVLQFGITKFIQRCAE
VGVSGLILPDLPVEIYERDYKKQFEASNLNFIGLVTPQSSDARIAKIDRASSGFIYAVSS
ASTTGSNKSVGNFKDYLDKLQNLNLKNPVLTGFNIKDHNSYQNACKHCRGAIIGSAFISH
LQTNGVANGSILNFVQKIKQSPS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacacactgaaatcaaaaaacaaggtccaaactctgtttgagcaaaagcagaaagat
attctaactatatactttaccgcaggtttccctaagctaaatgacacgcccaaaatccta
aacggacttgaagctgccggagtagatattattgaaataggaataccctacagcgaccca
ttggctgacggccctgtaattcaaaactcaagtacacttgcgctcaataatggaatgaca
ttggccaaactctttgagcaattagaacacgtaacgatagaagccccaatagttcttatg
ggctatctaaatccagttttacaatttggtataactaagtttatccaacgttgtgcggag
gttggtgtgagcggactcatacttcctgaccttcctgtggagatttatgagcgcgactat
aaaaagcaatttgaagcttccaatttgaattttataggtttagtaacaccgcaaagctcg
gatgcacgcattgcaaaaattgaccgagccagtagcggttttatttacgcggtttcttca
gcaagtactactgggtctaataagtctgtgggaaattttaaagattacctggacaagctt
caaaacttgaacttgaaaaacccagtgctcactggctttaatataaaagaccacaacagc
tatcagaatgcttgcaaacattgccgtggtgctattatcggttcggcatttatttcacac
ctccaaacaaatggtgttgcaaatggcagcattctgaattttgttcaaaaaataaaacaa
tctccatcatga

DBGET integrated database retrieval system