KEGG   Owenweeksia hongkongensis: Oweho_3104Help
Entry
Oweho_3104        CDS       T01677                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
oho  Owenweeksia hongkongensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oweho_3104
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oweho_3104
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oweho_3104
Enzymes [BR:oho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oweho_3104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3476023..3476814)
Genome map
AA seq 263 aa AA seqDB search
MNTLKSKNKVQTLFEQKQKDILTIYFTAGFPKLNDTPKILNGLEAAGVDIIEIGIPYSDP
LADGPVIQNSSTLALNNGMTLAKLFEQLEHVTIEAPIVLMGYLNPVLQFGITKFIQRCAE
VGVSGLILPDLPVEIYERDYKKQFEASNLNFIGLVTPQSSDARIAKIDRASSGFIYAVSS
ASTTGSNKSVGNFKDYLDKLQNLNLKNPVLTGFNIKDHNSYQNACKHCRGAIIGSAFISH
LQTNGVANGSILNFVQKIKQSPS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacacactgaaatcaaaaaacaaggtccaaactctgtttgagcaaaagcagaaagat
attctaactatatactttaccgcaggtttccctaagctaaatgacacgcccaaaatccta
aacggacttgaagctgccggagtagatattattgaaataggaataccctacagcgaccca
ttggctgacggccctgtaattcaaaactcaagtacacttgcgctcaataatggaatgaca
ttggccaaactctttgagcaattagaacacgtaacgatagaagccccaatagttcttatg
ggctatctaaatccagttttacaatttggtataactaagtttatccaacgttgtgcggag
gttggtgtgagcggactcatacttcctgaccttcctgtggagatttatgagcgcgactat
aaaaagcaatttgaagcttccaatttgaattttataggtttagtaacaccgcaaagctcg
gatgcacgcattgcaaaaattgaccgagccagtagcggttttatttacgcggtttcttca
gcaagtactactgggtctaataagtctgtgggaaattttaaagattacctggacaagctt
caaaacttgaacttgaaaaacccagtgctcactggctttaatataaaagaccacaacagc
tatcagaatgcttgcaaacattgccgtggtgctattatcggttcggcatttatttcacac
ctccaaacaaatggtgttgcaaatggcagcattctgaattttgttcaaaaaataaaacaa
tctccatcatga

DBGET integrated database retrieval system