KEGG   Owenweeksia hongkongensis: Oweho_3105Help
Entry
Oweho_3105        CDS       T01677                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
oho  Owenweeksia hongkongensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:oho01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:oho00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:oho00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3476811..3478631)
Genome map
AA seq 606 aa AA seqDB search
MNSSKLKLKVCGLKNPTNIMEVVDLQPDFAGFIFYPKSPRYAENLDPQILHNLSSEICSV
GVFVNESSSTIMEIVNRYKLRAVQLHGDETPSDCETLKNQGLVVIKAFGVHNDFDFTILE
DYLSVCDYFLFDTKTSKHGGSGQKFKWEILNNNPYSKPYFLSGGIGPTDLEKISKLNLSQ
PPFGIDVNSQFETKPGEKDISKLKDFMKQMNTHYASANSQTTPDADGFYGNYGGAFIPEL
LYPNVEELRNNYLRILEDPSFKEQQNQLLKDYVGRPTPLYFAKRLSEHFNTQIYLKREDL
CHTGAHKINNTIGQILLAKKLGKTRIIAETGAGQHGVATATAAALMNLPCIVYMGALDIQ
RQAPNVSRMRMLGAEVRAVHSGSKTLKDATNEAIRDWINNPEDTHYILGSVVGPHPYPDM
VTRFQAVISEEIKHQMNGLPDYVLACVGGGSNAIGAFYHFLKNKNVQLYGIEAAGHGVNT
NKTAATLAVGSSGVIHASKTILMQTEDGQIIEPHSISAGLDYPGIGPIHSHLHETNRVKY
VSITDEEALEAGYLLCKLEGIIPALESAHALAYLKYLKPQPHEKVVVNLSGRGDKDLNTY
LQYFEK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatccaagctcaaattaaaagtctgtggattaaaaaatcccacaaacatcatg
gaggtggttgatttacaaccggattttgccgggtttattttttatccaaaatctcccaga
tatgcggaaaatctggaccctcaaatactacacaatctttcgagtgaaatttgttctgtt
ggtgtttttgtcaatgaatcctcttccaccattatggaaattgtaaaccgctataagcta
agagcggtgcaactacacggagatgaaacaccaagcgactgtgaaaccctaaagaatcaa
ggacttgtagtaatcaaggcttttggtgtgcacaatgattttgactttaccattttggaa
gattacctgagtgtatgcgattatttcctatttgatactaagacaagtaaacatggaggt
tccggacaaaagttcaagtgggaaatactcaacaacaacccttattctaagccctacttt
ttgagtggcggaataggccctacagatttggaaaagatatccaaactcaacctaagtcag
cctccatttggcatagacgtaaatagccaatttgaaaccaagcccggtgaaaaagacatc
tctaaattaaaagactttatgaagcaaatgaatacacattatgcttccgcaaactcccaa
accactcctgatgctgatggtttttatggaaactacggtggagcatttatccctgagttg
ctttatccaaatgtggaggaacttcgaaataactacctgagaatactggaagacccgagt
tttaaggaacagcaaaatcaacttttaaaggactatgtagggcggcctactcctctttat
ttcgccaaaagactcagtgagcattttaatactcagatttacctaaagcgtgaggacctt
tgccacacaggagcgcacaaaataaataacaccatagggcaaattttacttgctaaaaaa
cttggcaaaacaagaatcattgctgaaaccggtgcgggacaacatggtgtagcgactgcc
acggcagctgccctaatgaacttgccctgcattgtatatatgggcgcacttgatattcag
cggcaagctcccaatgtgagccgtatgcgcatgcttggcgcagaagtacgtgctgtacac
agtggaagcaaaacgttgaaagatgctacaaatgaagctatccgcgactggataaataac
cccgaagacacacactacatactagggtcggtggtaggcccacatccttatccggatatg
gttacccggtttcaggcagtaattagcgaagaaataaagcaccaaatgaatggcttgcct
gattatgtgcttgcctgtgtaggcgggggaagcaatgccattggtgccttttaccatttt
ctaaaaaataaaaacgtgcagctgtatggtatagaggcggctggtcatggtgtaaacact
aacaaaactgcagccacattagccgtaggaagttcgggggttattcacgccagtaaaacc
attttaatgcaaaccgaagatggacaaattatagagccacacagcatttccgcaggcctt
gactacccgggcatcggtcctattcattctcatttacatgaaacaaaccgtgtgaaatac
gtctcaattacggatgaggaagcactggaggctggatacttattatgcaaattagaagga
attatccctgctctagaatctgcacacgcactggcatatttgaaatacctaaagccacag
ccgcatgaaaaagtagtggttaacctaagtggaagaggtgataaagaccttaacacttac
ctacaatattttgaaaaatga

DBGET integrated database retrieval system