KEGG   Owenweeksia hongkongensis: Oweho_3105Help
Entry
Oweho_3105        CDS       T01677                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
oho  Owenweeksia hongkongensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oweho_3105
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oweho_3105
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oweho_3105
Enzymes [BR:oho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oweho_3105
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Oweho_3105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3476811..3478631)
Genome map
AA seq 606 aa AA seqDB search
MNSSKLKLKVCGLKNPTNIMEVVDLQPDFAGFIFYPKSPRYAENLDPQILHNLSSEICSV
GVFVNESSSTIMEIVNRYKLRAVQLHGDETPSDCETLKNQGLVVIKAFGVHNDFDFTILE
DYLSVCDYFLFDTKTSKHGGSGQKFKWEILNNNPYSKPYFLSGGIGPTDLEKISKLNLSQ
PPFGIDVNSQFETKPGEKDISKLKDFMKQMNTHYASANSQTTPDADGFYGNYGGAFIPEL
LYPNVEELRNNYLRILEDPSFKEQQNQLLKDYVGRPTPLYFAKRLSEHFNTQIYLKREDL
CHTGAHKINNTIGQILLAKKLGKTRIIAETGAGQHGVATATAAALMNLPCIVYMGALDIQ
RQAPNVSRMRMLGAEVRAVHSGSKTLKDATNEAIRDWINNPEDTHYILGSVVGPHPYPDM
VTRFQAVISEEIKHQMNGLPDYVLACVGGGSNAIGAFYHFLKNKNVQLYGIEAAGHGVNT
NKTAATLAVGSSGVIHASKTILMQTEDGQIIEPHSISAGLDYPGIGPIHSHLHETNRVKY
VSITDEEALEAGYLLCKLEGIIPALESAHALAYLKYLKPQPHEKVVVNLSGRGDKDLNTY
LQYFEK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatccaagctcaaattaaaagtctgtggattaaaaaatcccacaaacatcatg
gaggtggttgatttacaaccggattttgccgggtttattttttatccaaaatctcccaga
tatgcggaaaatctggaccctcaaatactacacaatctttcgagtgaaatttgttctgtt
ggtgtttttgtcaatgaatcctcttccaccattatggaaattgtaaaccgctataagcta
agagcggtgcaactacacggagatgaaacaccaagcgactgtgaaaccctaaagaatcaa
ggacttgtagtaatcaaggcttttggtgtgcacaatgattttgactttaccattttggaa
gattacctgagtgtatgcgattatttcctatttgatactaagacaagtaaacatggaggt
tccggacaaaagttcaagtgggaaatactcaacaacaacccttattctaagccctacttt
ttgagtggcggaataggccctacagatttggaaaagatatccaaactcaacctaagtcag
cctccatttggcatagacgtaaatagccaatttgaaaccaagcccggtgaaaaagacatc
tctaaattaaaagactttatgaagcaaatgaatacacattatgcttccgcaaactcccaa
accactcctgatgctgatggtttttatggaaactacggtggagcatttatccctgagttg
ctttatccaaatgtggaggaacttcgaaataactacctgagaatactggaagacccgagt
tttaaggaacagcaaaatcaacttttaaaggactatgtagggcggcctactcctctttat
ttcgccaaaagactcagtgagcattttaatactcagatttacctaaagcgtgaggacctt
tgccacacaggagcgcacaaaataaataacaccatagggcaaattttacttgctaaaaaa
cttggcaaaacaagaatcattgctgaaaccggtgcgggacaacatggtgtagcgactgcc
acggcagctgccctaatgaacttgccctgcattgtatatatgggcgcacttgatattcag
cggcaagctcccaatgtgagccgtatgcgcatgcttggcgcagaagtacgtgctgtacac
agtggaagcaaaacgttgaaagatgctacaaatgaagctatccgcgactggataaataac
cccgaagacacacactacatactagggtcggtggtaggcccacatccttatccggatatg
gttacccggtttcaggcagtaattagcgaagaaataaagcaccaaatgaatggcttgcct
gattatgtgcttgcctgtgtaggcgggggaagcaatgccattggtgccttttaccatttt
ctaaaaaataaaaacgtgcagctgtatggtatagaggcggctggtcatggtgtaaacact
aacaaaactgcagccacattagccgtaggaagttcgggggttattcacgccagtaaaacc
attttaatgcaaaccgaagatggacaaattatagagccacacagcatttccgcaggcctt
gactacccgggcatcggtcctattcattctcatttacatgaaacaaaccgtgtgaaatac
gtctcaattacggatgaggaagcactggaggctggatacttattatgcaaattagaagga
attatccctgctctagaatctgcacacgcactggcatatttgaaatacctaaagccacag
ccgcatgaaaaagtagtggttaacctaagtggaagaggtgataaagaccttaacacttac
ctacaatattttgaaaaatga

DBGET integrated database retrieval system