KEGG   Owenweeksia hongkongensis: Oweho_3106Help
Entry
Oweho_3106        CDS       T01677                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oho01100  Metabolic pathways
oho01110  Biosynthesis of secondary metabolites
oho01130  Biosynthesis of antibiotics
oho01230  Biosynthesis of amino acids
Module
oho_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oweho_3106
Enzymes [BR:oho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Oweho_3106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEV34060
UniProt: G8R335
Position
complement(3478628..3479440)
Genome map
AA seq 270 aa AA seqDB search
MNILERIINHKKKEVAERVSLYPTTLLQRSPYFQTTPLSLVLYLKRPEGHGIIAEIKRKS
PSKGAINLYVDVEQTSIGYMQSGASALSVLTDNEFFGGSNADLTTARKFNYCPILRKDFI
IDKYQITEAKSIGADAILLIAAALTPEQCRTLAKYANDLNMEVLLEVHNRNEIESYLNEY
VQLVGVNNRDLRTFETRLETSLNLAEIIPDSFLKISESGLKTPKDVELLKQHGYSGFLMG
ERFMQEANPAKACSEFIRQLSTNAHSKSVI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttagaaagaataataaaccacaaaaagaaagaggtggcggagcgagtttcg
ctatatcctaccacccttctgcaaagaagcccctatttccaaactactcctctctcctta
gttttatatctaaagcgacctgaaggtcatggtattattgctgaaatcaaaagaaagtca
cctagcaagggggctataaatttgtatgtagatgtagaacaaacgagcattggttatatg
caatccggtgcctctgccctttcggtgctcaccgataatgagttttttggtggtagcaat
gccgaccttaccacggctcgaaaattcaactactgccccattctaaggaaagatttcatc
attgataaatatcaaattaccgaagccaaaagcataggtgccgatgccattttgctaatt
gccgcagctcttactcccgagcaatgtagaacattggctaagtatgctaatgacctaaat
atggaagtgctattggaagtccataaccgcaatgaaattgagagctaccttaatgaatat
gtacagcttgtgggggtaaacaaccgagaccttagaacatttgaaacccgcttagaaacc
tctcttaatttggcagaaataattcctgatagttttttaaaaatcagcgaaagcggacta
aaaaccccgaaagatgtagagctacttaaacaacatggatatagtggttttttgatgggg
gaaagatttatgcaagaagccaaccctgcaaaagcgtgctctgagtttatccgccaacta
tctaccaatgctcactcaaaatccgtgatatga

DBGET integrated database retrieval system