KEGG   Owenweeksia hongkongensis: Oweho_3132Help
Entry
Oweho_3132        CDS       T01677                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
oho  Owenweeksia hongkongensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oho00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3507132..3507836)
Genome map
AA seq 234 aa AA seqDB search
MSTDKNNDHLVVSDDMMDDAGDAHISGRAETPMRADAFDKSEAEKIESIRQNFENIMNTL
GLDLTDDSLKGTPLRVAKMFVKEIFGGLDPAREPKASVFDNKYKYGEMLVEKNIVVYSTC
EHHFLPIVGRAHVAYISNGTVIGLSKMNRIVDYFAKRPQVQERMTKQIVQALQVALGTDD
VACVIDAKHLCVNSRGIRDIESSTVTAEFGGKFQEDSVKRDFLDYINMKTTFDA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagataaaaacaatgaccacttggtggtatcagatgacatgatggacgatgcc
ggtgatgcgcacatttcaggaagagctgaaacccctatgcgcgctgacgcttttgataag
tctgaagcggaaaagattgagtctatccgtcagaattttgaaaatataatgaacaccttg
ggacttgatcttacagatgatagcctgaaaggaaccccacttcgtgtggcaaaaatgttt
gttaaagaaatttttggaggccttgatcctgcaagagaacccaaggcaagtgtatttgac
aacaaatacaagtacggtgaaatgttggtagagaaaaacattgtcgtttattctacctgc
gagcatcactttttgccaatcgttggccgtgctcatgtagcttacatcagcaatggtacc
gtgattggtcttagcaaaatgaaccgtattgtagattattttgcaaaacgcccacaagta
caggagcgtatgaccaagcaaatcgtacaagctttgcaagtagccttgggcacagatgac
gtagcctgtgtgatagatgccaagcacctttgtgtaaactcacgcggtatccgcgatatt
gaaagcagcaccgtaactgcagagtttggtggtaagtttcaggaagatagcgtgaagcgt
gatttcttggattatataaacatgaaaaccaccttcgatgcataa

DBGET integrated database retrieval system