KEGG   Owenweeksia hongkongensis: Oweho_3309Help
Entry
Oweho_3309        CDS       T01677                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
oho  Owenweeksia hongkongensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:oho00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3712441..3714258
Genome map
AA seq 605 aa AA seqDB search
MCGIYMTNLPVTEENVRGRMKEIDFRGPDNLGYQKVNSITMSHLRLSILDLESRSNQPFR
YEHLHIVFNGEIYNFLDIKEELIAKGYTFDTTSDTEVLIKGYDAWGKDLLPRLNGMFAFS
IYDESKNEIFSARDRLGVKPFFYYWNKGNFEICSQLRPLIKADSKISEEAVSIYLDCGYV
PSPLSIIENVYKLRPGNFMIINLNTGEKSIKEYWGLEPVVERNVSYEDAREEIHQLLNDA
VKIRLHADVSLGSFLSGGVDSALVTAIAAKNSPTKIKTFSIGFDDPRYDESQAAAEYAKI
LGTEHTEIMCSPKDALEMLPLLIKAYDEPFADSSALPSLLLNKVTKQHVTVALSGDGGDE
SFLGYNNFYALERFNRISRIPSALRKIAFGILSRLPGKASLKNKFKILGITDSDEFTLKR
FIGYNSIQRKRKLTWVNKFYSEYKENSSNSLQRMADLNIKLWLENDSNTKVDRASMASSV
EVRSPFLDYRIIEAARELPVSYRYGNGQRKKILKDILEDYIPKEVFTRPKKGFSIPLSKW
IQQDLKQEFYEALTDSFFESIPNLNVKKARAYLEDHMSGKDDHSFNLWKLFVLSKWMKEF
GFHNK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatatatatgaccaacctgccggtaactgaagaaaatgtgagaggcaggatg
aaggagatagattttagaggaccagataatttaggttatcagaaggtaaactctataact
atgtctcacctcaggctttcaattttagatttggaaagtagatccaatcagcctttccgg
tatgagcatcttcatattgtttttaatggtgagatttacaattttttggatataaaggaa
gagcttattgctaagggttacacctttgacacaacaagtgacactgaggtattgataaaa
ggatatgatgcttggggaaaagatttgctcccgcgcctcaatggaatgtttgcctttagt
atatatgacgaaagtaaaaacgagatttttagtgcccgggataggttaggggtaaaaccg
tttttttactattggaacaaaggtaacttcgaaatatgtagccagcttagacctttgata
aaagcagatagtaaaatatctgaagaggccgtttcaatttatctggattgtggatatgtg
cccagcccattatcaattatagagaatgtgtacaagctaaggcccggtaattttatgatt
atcaaccttaatacaggtgaaaaaagcattaaagaatactggggacttgagcctgtagta
gagcgaaatgtttcttatgaagatgctcgtgaagaaatacatcaattgctaaatgacgcg
gtaaaaataaggctccacgcggatgtttctttgggttcatttttatcaggtggagtggac
tcagctttggtaaccgctattgcagcaaaaaatagccctactaaaatcaaaactttttca
attggttttgatgatccgcgttatgatgaaagccaggctgcagcagaatatgccaaaatt
ttaggtacggaacacacggaaataatgtgtagccctaaggatgcgctggaaatgctacca
cttttaataaaagcttatgatgaaccctttgctgacagctctgctcttccttccctatta
cttaataaagttacaaagcaacatgtaactgtagctctatcaggtgatggtggagacgaa
agttttttgggatataataatttttatgctttggagaggtttaatcggattagccgtatc
ccatcggctttacgaaagattgcatttggaattttatctagactacccggtaaagcttct
cttaaaaataaattcaaaatattaggaattaccgattcagatgaatttacactaaaacgc
tttattggatataattctattcagaggaaaagaaaactcacttgggtgaataaattttac
tcggagtataaagaaaactcatccaattctttgcaacgaatggctgacctaaatattaag
ctttggcttgaaaatgatagcaatacaaaggtagatagggcaagtatggcaagttcggtt
gaagtaagaagtccattcttagattatcgtataattgaagcggctagagagctacctgtg
tcatatagatatggaaatggacaaagaaagaaaatattaaaagatattcttgaggactat
attcctaaggaagtttttacaagacctaaaaaagggttttcaatacctcttagtaaatgg
attcaacaggatctgaagcaagagttttatgaggctttgacagattctttttttgaaagt
attcctaatttaaatgtaaagaaagccagagcatatttagaagatcatatgagtggtaaa
gatgaccattcttttaatttatggaagctttttgtgctgtcaaaatggatgaaggaattt
ggttttcacaataaatag

DBGET integrated database retrieval system