KEGG   Owenweeksia hongkongensis: Oweho_3349Help
Entry
Oweho_3349        CDS       T01677                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oho  Owenweeksia hongkongensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oweho_3349
   01230 Biosynthesis of amino acids
    Oweho_3349
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oweho_3349
   00051 Fructose and mannose metabolism
    Oweho_3349
   00562 Inositol phosphate metabolism
    Oweho_3349
Enzymes [BR:oho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Oweho_3349
Exosome [BR:oho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Oweho_3349
  Exosomal proteins of bladder cancer cells
   Oweho_3349
  Exosomal proteins of melanoma cells
   Oweho_3349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3751405..3752175
Genome map
AA seq 256 aa AA seqDB search
MARKIVAGNWKMNLLPDEGYQLIEDLSNFCEGNKLDNVEVVVSPPFIHLAKAAEMTAHSK
LTISAQNCSDQLSGAYTGEVSVEMLKAAGVNWTLIGHSERREYYGDTDEFVNGKLKRTIE
AEMTPVLCVGEVLEDRKAGKQEEVVASQLKGALAGFSADEVKNMVIAYEPVWAIGTGETA
SPEQAQEVHAFIRKYLTQTYSAEVANAVSILYGGSVKPENAKEIFGQPDVDGGLIGGASL
KYEQFVKLIEIGQEVL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaaaaatagtagcgggaaactggaaaatgaacctcctgccagacgaaggatat
cagttaatcgaagacctttcaaacttttgtgaagggaacaagttggataatgtggaagta
gtggtatcgccaccgtttatccatttggcgaaagccgcagaaatgacggctcactcaaaa
ttgaccatatctgcacaaaactgcagcgatcaattgagcggtgcctacacaggcgaagta
agcgtggaaatgctgaaagcagctggtgtaaactggacattgattggccactctgagcgt
agagaatattatggcgataccgatgagtttgtaaacggaaaactgaagcgcaccattgaa
gccgagatgacccctgtactttgtgtaggcgaagtgttggaagatagaaaagctggtaag
caggaagaagttgttgcttctcagctaaaaggggctttagctggattttcggctgatgag
gtaaaaaatatggtgattgcttatgagccagtttgggctatagggacgggtgaaactgct
tctccagagcaggctcaggaagtacatgcttttattagaaagtatcttacccagacttac
tcggctgaggtggcaaatgcggtaagcatcctgtatggaggatcggtaaagccggaaaat
gccaaagagatttttgggcaaccagatgtagatggaggccttattggtggggcatctttg
aagtatgagcaatttgtaaagttgattgaaataggacaagaggtactgtaa

DBGET integrated database retrieval system