KEGG   Owenweeksia hongkongensis: Oweho_3349Help
Entry
Oweho_3349        CDS       T01677                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00010  Glycolysis / Gluconeogenesis
oho00051  Fructose and mannose metabolism
oho00562  Inositol phosphate metabolism
oho01100  Metabolic pathways
oho01110  Biosynthesis of secondary metabolites
oho01120  Microbial metabolism in diverse environments
oho01130  Biosynthesis of antibiotics
oho01200  Carbon metabolism
oho01230  Biosynthesis of amino acids
Module
oho_M00002  Glycolysis, core module involving three-carbon compounds
oho_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oweho_3349
   00051 Fructose and mannose metabolism
    Oweho_3349
   00562 Inositol phosphate metabolism
    Oweho_3349
Enzymes [BR:oho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Oweho_3349
Exosome [BR:oho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Oweho_3349
  Exosomal proteins of bladder cancer cells
   Oweho_3349
  Exosomal proteins of melanoma cells
   Oweho_3349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEV34300
UniProt: G8R4Y6
Position
3751405..3752175
Genome map
AA seq 256 aa AA seqDB search
MARKIVAGNWKMNLLPDEGYQLIEDLSNFCEGNKLDNVEVVVSPPFIHLAKAAEMTAHSK
LTISAQNCSDQLSGAYTGEVSVEMLKAAGVNWTLIGHSERREYYGDTDEFVNGKLKRTIE
AEMTPVLCVGEVLEDRKAGKQEEVVASQLKGALAGFSADEVKNMVIAYEPVWAIGTGETA
SPEQAQEVHAFIRKYLTQTYSAEVANAVSILYGGSVKPENAKEIFGQPDVDGGLIGGASL
KYEQFVKLIEIGQEVL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaaaaatagtagcgggaaactggaaaatgaacctcctgccagacgaaggatat
cagttaatcgaagacctttcaaacttttgtgaagggaacaagttggataatgtggaagta
gtggtatcgccaccgtttatccatttggcgaaagccgcagaaatgacggctcactcaaaa
ttgaccatatctgcacaaaactgcagcgatcaattgagcggtgcctacacaggcgaagta
agcgtggaaatgctgaaagcagctggtgtaaactggacattgattggccactctgagcgt
agagaatattatggcgataccgatgagtttgtaaacggaaaactgaagcgcaccattgaa
gccgagatgacccctgtactttgtgtaggcgaagtgttggaagatagaaaagctggtaag
caggaagaagttgttgcttctcagctaaaaggggctttagctggattttcggctgatgag
gtaaaaaatatggtgattgcttatgagccagtttgggctatagggacgggtgaaactgct
tctccagagcaggctcaggaagtacatgcttttattagaaagtatcttacccagacttac
tcggctgaggtggcaaatgcggtaagcatcctgtatggaggatcggtaaagccggaaaat
gccaaagagatttttgggcaaccagatgtagatggaggccttattggtggggcatctttg
aagtatgagcaatttgtaaagttgattgaaataggacaagaggtactgtaa

DBGET integrated database retrieval system