KEGG   Owenweeksia hongkongensis: Oweho_3394Help
Entry
Oweho_3394        CDS       T01677                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
oho  Owenweeksia hongkongensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Oweho_3394
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Oweho_3394
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Oweho_3394
Enzymes [BR:oho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Oweho_3394
Exosome [BR:oho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Oweho_3394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3807466..3808560
Genome map
AA seq 364 aa AA seqDB search
MKVNFISLAFALVVLATCSSFINKDEYQKPKNIIIMIGDGMGLSQMSAAYYYGDKEPNFS
RFPIVGLSRTSSSSDKITDSAAGATAISAGKKTYNGAIGLDEDKKCVETLLEYFSKEGKS
TGLVATSSITHATPASFFAHEKSRNSASSIAKQMLESPVDFFAGGGLKYFQKGSLIQDLE
EKGFTINTTELDKKAPKIEGGRLGYILADDGMPKMIEGRGEYLKNASELAIDFLKDDEDG
FFMMIEGSQIDWGGHANNSKYVISEVLDFDQTVGAVLDFARKDGKTLVIVTADHETGGFT
LAAEEKKVPFQGTKRDYNSIAPRFSTGGHSAAMVPVLAYGPGAEKFAGIYENTEIHAKIL
ELVK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaactttatctctctggcatttgctctagtggttttagcaacatgttcttct
tttatcaataaagatgaataccaaaaacccaaaaacataataataatgattggtgacgga
atgggcctaagccagatgtcggcagcatattattatggagataaggagccaaatttttcg
cgctttccaattgtgggtctaagtcgtacctcttccagttcagataagataacagattcg
gcagcaggagccactgcaatatcagcagggaaaaaaacctacaatggagctattggactt
gatgaggataaaaagtgcgtggaaactttgttagagtatttctctaaggaaggaaaaagc
acaggtttggtggctacatcatcgattactcacgccactccggcctcatttttcgcacat
gagaaatcaaggaatagtgcttctagtattgctaaacaaatgttggaatcaccagtggat
ttctttgcaggtggaggacttaaatattttcaaaaagggagcttaattcaggatttggaa
gaaaaaggttttaccatcaatactaccgaattggataaaaaagctccaaaaattgaagga
ggaagattgggatatattttggctgatgatggaatgccaaaaatgatagaagggcgtggg
gagtatttgaaaaatgccagcgagttagctattgattttttgaaggatgatgaagatggc
ttcttcatgatgattgaaggatcgcagattgattggggtggccatgccaataattctaaa
tatgtaatttcagaagtgcttgattttgatcagacggtgggagccgttttagactttgct
cgtaaggatgggaaaactttggtgatagttactgcagatcatgaaaccggaggttttacg
cttgctgctgaagaaaagaaagttccttttcaaggaacaaagcgtgactataactctatt
gctccaaggttttctacaggagggcatagcgcagcaatggtacctgttttagcttatggg
ccaggagcggaaaagtttgcgggtatttatgaaaacaccgagatacacgctaaaatttta
gaattggtaaaatag

DBGET integrated database retrieval system