KEGG   Owenweeksia hongkongensis: Oweho_3463Help
Entry
Oweho_3463        CDS       T01677                                 

Definition
nitrous oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
oho  Owenweeksia hongkongensis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Oweho_3463
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Oweho_3463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3875198..3877165)
Genome map
AA seq 655 aa AA seqDB search
MNRLTKIMAVVALAMTLPQGCNNNSEAGTEKSGAINRSSAAEKVYVAPGEYDEFYSFMSG
GFSGQISVYGLPSGRLLKVIPVFSVDGEKGYGFNEETKPLLETTHGFIPWDDAHHPELSQ
TNGVPDGKYIFINGNNTPRVARVDLTTFETAEIIELPNAGGNHSSPFTTENSEYVVAGTR
FSVPVPQKDVPIATYKENFKGALSFISVDPEHGHMDIDFQVLMPGYDYDLAHAGKGKSHG
WMFFTTYNTEQSHTLKEVNASQNDKDYIAAINWKKAQEYIKDGKFKEMDTEYLINRYDEN
KHMAETIKRNKVRVLDASEYPGVVYFLPTPKSPHGVDVDPTGSYIIGNGKLNANLTVHSF
DKMIQAIENESFAGDAYGIPVLNFEDVVAGTVESGGLGPLHTEFDGKGNAYTTFFISSEV
VKWKLDTWEVLDRIPTYYSVGHLMIPGGDSKEPWGKYMVALNKITKDRYLPTGPELAHSA
QLYDISGDKMELILDFPTIGEPHYAQAIPADLVAPNSKKIYSLEENAHPYATKSEKDTRV
EKKGNEVHIYMTTIRSHFAPDNVEGIEVGDKVYFHVTNLEQDWDVPHGFSVMGAQTAELL
IMPGQTETLLWEPKKPGVIPFYCTDFCSALHQEMQGYLRVSAKGQAPEVTATTGE
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtttaaccaaaataatggccgtggtggctcttgcgatgaccctgccacaaggc
tgtaacaacaacagtgaggcaggcaccgaaaaaagtggtgccataaacagatcaagcgct
gcagaaaaagtatatgtagcccctggcgaatacgatgagttttactcttttatgtctggt
ggttttagtggacaaataagtgtgtatgggcttccatctggccgtcttctcaaggttatc
ccagtattttctgtagatggtgaaaaaggttatggttttaatgaagaaaccaaacctttg
cttgaaaccactcatggttttatcccttgggatgatgctcaccaccctgagctttctcaa
acaaatggagtacctgacggaaagtatattttcattaatggtaacaacacaccacgagta
gcccgagtagatcttactacttttgaaactgctgaaatcattgaacttccaaatgccggt
ggaaatcacagttctccttttaccaccgaaaacagtgagtatgtagtggccggaacacgt
tttagtgtacctgtgcctcaaaaagatgtgccgattgctacctacaaggaaaactttaag
ggagccttgtcttttatttctgtagacccggagcatggtcatatggatattgactttcaa
gtactgatgcctgggtatgattatgatttggcacatgccggaaaaggaaaatctcatggc
tggatgttttttaccacatacaacactgagcaaagccatacgctgaaagaagtaaacgct
tctcaaaacgataaggattacatagccgccatcaactggaaaaaagcccaggagtatatc
aaggatggtaagtttaaggaaatggatacagaatatttgataaaccgttatgacgaaaac
aagcacatggcggaaactattaaaaggaacaaagtgcgtgtacttgatgcaagcgagtac
ccgggagtagtttacttcttgcctacaccaaaatctccacacggagtggacgtagaccct
acaggttcttacattattggtaacggtaagcttaatgcaaaccttactgtgcacagcttt
gacaaaatgattcaggccatcgaaaatgaatcttttgccggagacgcttatggaattcct
gtgctaaactttgaagatgtggtagccggaactgtagaaagtggcggcctcggaccattg
cacaccgagtttgatggaaaaggaaatgcctacaccacattctttatcagtagtgaagtt
gtaaaatggaaattggatacttgggaagtacttgatcgtattcctacgtattactctgtt
ggtcacctaatgatacctggtggagatagtaaagagccttggggcaaatacatggtggcg
cttaacaaaatcaccaaagaccgctacctgcctaccggtcctgagttagcacactctgct
caattgtatgacattagtggagacaaaatggagctcattcttgacttccctaccattggt
gagcctcactatgcacaggccataccagccgacctggtagcaccaaacagtaagaaaatt
tacagcttagaagaaaatgcgcacccatatgccaccaagagtgaaaaagacactcgtgtg
gagaaaaagggcaatgaagtacacatttatatgaccactatacgtagccactttgctcct
gataatgtagaaggtattgaggttggtgacaaagtatattttcatgtaactaaccttgag
caagactgggatgtaccacacggattttcagtaatgggcgcacaaactgccgaactactg
ataatgcccggacaaaccgaaaccttactgtgggagcctaaaaagccaggggtaattcca
ttctactgtactgacttttgctctgcactgcaccaggaaatgcaaggatacttaagagtt
tctgccaaagggcaagctcctgaagtaactgctaccactggtgagtaa

DBGET integrated database retrieval system