KEGG   Oceanobacillus iheyensis: OB0015Help
Entry
OB0015            CDS       T00093                                 

Definition
(GenBank) deoxypurine kinase subunit
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00230  Purine metabolism
oih00240  Pyrimidine metabolism
oih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OB0015
   00240 Pyrimidine metabolism
    OB0015
Enzymes [BR:oih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     OB0015
    2.7.1.76  2'-deoxyadenosine kinase
     OB0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_15 TsaE RsgA_GTPase AAA_28 Cytidylate_kin2 AAA_33 AAA_29 AAA_22 ABC_tran MMR_HSR1 RNA_helicase MSP7_C AAA_16 ParA ATP_bind_1 AAA
Motif
Other DBs
NCBI-ProteinID: BAC11971
JAMSTEC: OB0015
UniProt: Q8EU74
Position
complement(18952..19638)
Genome map
AA seq 228 aa AA seqDB search
MNLREKYQIPNDSIITIAGTVGVGKSTMTNALAEALHFKTSFEKVDSNPYLSDFYNDFER
WSFHLQIYFLAERFKEQKKIFEYGGGFIQDRSIYEDTGIFAKMHYDNGTMNPTDYDTYKS
LFDAMVMTPYFPHPDLLIYLEGSFDEIVSRIKSRGRDMEKNTPIEYWEEMYRRYSDWIDN
FNACPVLRINISDYDLMKEDDSLALILEKIGRSIQLSRKYKKGEIITN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacgtgaaaaataccaaattccaaatgacagcattataaccattgcaggaaca
gttggagttggaaaatcaacaatgaccaatgcattagcagaggcattacactttaaaact
tcatttgaaaaagtggattctaatccctatttaagtgatttttataatgactttgaacgt
tggagcttccatttgcaaatctatttcttagcagaacgctttaaagagcagaaaaagatt
tttgaatatggtggcggatttattcaagatcgttctatttatgaagataccggtattttt
gctaaaatgcattacgataatggaaccatgaatccaactgattacgatacgtacaaaagc
ttatttgatgcgatggtaatgacgccgtattttccacatccggatttactcatatatcta
gaaggatcttttgatgagatcgtttcacgaatcaaaagtcgtgggcgtgatatggagaag
aatactccaattgagtattgggaagaaatgtatcgccgatatagtgattggatagataac
ttcaatgcttgtccggtgttacgaattaacatctcggattatgatttaatgaaagaagat
gattccctagcgttaattttagaaaagatagggcgctccattcaactttctagaaaatat
aaaaaaggtgaaattatcaccaactaa

DBGET integrated database retrieval system