KEGG   Oceanobacillus iheyensis: OB0015Help
Entry
OB0015            CDS       T00093                                 

Definition
deoxypurine kinase subunit
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
oih  Oceanobacillus iheyensis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OB0015
   00240 Pyrimidine metabolism
    OB0015
Enzymes [BR:oih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     OB0015
    2.7.1.76  2'-deoxyadenosine kinase
     OB0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
complement(18952..19638)
Genome map
AA seq 228 aa AA seqDB search
MNLREKYQIPNDSIITIAGTVGVGKSTMTNALAEALHFKTSFEKVDSNPYLSDFYNDFER
WSFHLQIYFLAERFKEQKKIFEYGGGFIQDRSIYEDTGIFAKMHYDNGTMNPTDYDTYKS
LFDAMVMTPYFPHPDLLIYLEGSFDEIVSRIKSRGRDMEKNTPIEYWEEMYRRYSDWIDN
FNACPVLRINISDYDLMKEDDSLALILEKIGRSIQLSRKYKKGEIITN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacgtgaaaaataccaaattccaaatgacagcattataaccattgcaggaaca
gttggagttggaaaatcaacaatgaccaatgcattagcagaggcattacactttaaaact
tcatttgaaaaagtggattctaatccctatttaagtgatttttataatgactttgaacgt
tggagcttccatttgcaaatctatttcttagcagaacgctttaaagagcagaaaaagatt
tttgaatatggtggcggatttattcaagatcgttctatttatgaagataccggtattttt
gctaaaatgcattacgataatggaaccatgaatccaactgattacgatacgtacaaaagc
ttatttgatgcgatggtaatgacgccgtattttccacatccggatttactcatatatcta
gaaggatcttttgatgagatcgtttcacgaatcaaaagtcgtgggcgtgatatggagaag
aatactccaattgagtattgggaagaaatgtatcgccgatatagtgattggatagataac
ttcaatgcttgtccggtgttacgaattaacatctcggattatgatttaatgaaagaagat
gattccctagcgttaattttagaaaagatagggcgctccattcaactttctagaaaatat
aaaaaaggtgaaattatcaccaactaa

DBGET integrated database retrieval system