KEGG   Oceanobacillus iheyensis: OB0031Help
Entry
OB0031            CDS       T00093                                 

Definition
(GenBank) recombination protein (DNA repair and genetic recombination)
  KO
K06187  recombination protein RecR
Organism
oih  Oceanobacillus iheyensis
Pathway
oih03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:oih00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OB0031
DNA repair and recombination proteins [BR:oih03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     OB0031
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      OB0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: BAC11987
JAMSTEC: OB0031
UniProt: Q8EU58
Position
35698..36294
Genome map
AA seq 198 aa AA seqDB search
MYYPEPITKLIDSFSKLPGIGPKTAARLAFFVLNMKEDDVLNFANALVSAKRELSHCSVC
GHITDQDPCAICTDTSRDGSLICVVQDPKDVIAMEKMKEFHGKYHVLHGAISPMDGIGPE
DINVPDLINRLKDEEVEELILATNPNIEGEATAMYISRLVKPSGIRTTRIAHGLPVGGDL
EYADEVTLSKALEGRRDV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccagaacctatcacgaaattaatagatagcttctctaaattgccaggaatc
ggccccaaaacggccgctcgtttggctttctttgtgttgaatatgaaagaagatgacgta
ttaaattttgcgaatgcactagttagtgcaaaacgagaattatctcattgttccgtatgt
ggccatataacggatcaagatccatgtgcaatctgtacggatacgagccgtgatggatca
cttatttgtgttgttcaggatccaaaagatgtcattgcaatggaaaagatgaaagaattc
cacgggaaataccatgtgttacatggagcgatttcacctatggatggaattggaccagag
gatatcaatgttcctgacttaattaaccgtttaaaggatgaggaagtagaagaacttata
cttgcaacgaatcccaatatcgaaggtgaagcaactgcaatgtatatttcacgattagta
aaaccatctggaattcgaacgacaaggattgctcatggtttgccagtaggtggagatcta
gagtatgcagatgaagtaaccttatcaaaagcattagaaggtagaagagacgtttaa

DBGET integrated database retrieval system