KEGG   Oceanobacillus iheyensis: OB0085Help
Entry
OB0085            CDS       T00093                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00790  Folate biosynthesis
oih01100  Metabolic pathways
Module
oih_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OB0085
Enzymes [BR:oih01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     OB0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase FtsH_ext ThiG
Motif
Other DBs
NCBI-ProteinID: BAC12041
JAMSTEC: OB0085
UniProt: Q8EU13
Position
87477..88298
Genome map
AA seq 273 aa AA seqDB search
MNIRTKKRTLNVSKRTHIMGILNVTPDSFSDGGNYSTVNKAVDQALQLEKQGADMIDIGG
ESTRPGYTPISAEEELNRIIPVIRILKDKLSIPISVDTFKAETARKVLEAGADMINDIWG
AKKDPDMAKVVAEYNVPIILMHNRKEEDYSDFMEDVKSDLLESIQIAKDAGISEDNIIID
PGVGFAKSMEQNMEVVRELHQLVNLGYPVLLATSRKRFIGHVLDVPAADRDVGTAATTVI
GVQQGAHIVRVHNVHINAEAAKVADAIYGKRSL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgaatattcgaacgaagaaacgaacattaaatgtttctaaacgaacacatatcatgggc
atactaaatgtaactccggattctttttcagatggagggaactattcaactgttaataaa
gctgtcgaccaagctttgcaattagaaaagcaaggggcggatatgattgatataggagga
gaatcgacacgaccaggctacactccaatctctgccgaagaggagttgaatcgaattatt
ccagttattcgaatccttaaagacaaattaagtattccgatatcggtggatacgtttaaa
gcagagacagctagaaaagtgttagaagcaggagcagatatgatcaatgatatatgggga
gcaaaaaaggatccagatatggcgaaggttgtagcagaatataatgttccaattatttta
atgcataatcgtaaagaagaagattatagtgatttcatggaagacgtaaaatccgattta
ttggaaagtattcaaattgcaaaagatgcagggattagcgaggataacattattattgat
cctggtgtaggttttgcaaaaagcatggaacagaatatggaagtagtacgagagttacat
caattagttaatctaggttatccggtactattagccacttcacgtaaaaggtttattgga
catgtattagatgtacctgcagctgatcgtgatgttggtactgctgctactacagtaatt
ggagtacagcaaggagctcatatagtacgagtgcataatgtacatatcaatgcagaagct
gccaaggtcgcagatgctatctatgggaaaaggagtctttag

DBGET integrated database retrieval system