KEGG   Oceanobacillus iheyensis: OB0263Help
Entry
OB0263            CDS       T00093                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00480  Glutathione metabolism
oih00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    OB0263
  Metabolism of other amino acids
   00480 Glutathione metabolism
    OB0263
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OB0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAC12219
JAMSTEC: OB0263
UniProt: Q8ETJ7
Position
296223..296696
Genome map
AA seq 157 aa AA seqDB search
MSIYEYQVEKSNGEEISLSQYQDNVLLIVNTATKCGFANQFEGLEELHQKYQDEGLRVLG
FPSNQFNEQEPVDDENMEEACKVNFGVTFPLFKKIDVKGPNAAPLFKYLTEEQKGLLGSN
VKWNFTKFLVDRNGNVVKRFAPKDKPAKIEDDIKALL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtctatatacgagtaccaagttgaaaaaagtaatggagaagaaatttcactatctcag
tatcaggacaacgttttattaattgttaatacagcaactaagtgtgggtttgcaaatcaa
tttgaaggattagaggaattgcaccaaaaatatcaagatgaagggctgcgtgttctcgga
tttccaagtaatcaatttaacgaacaagaaccagttgatgatgaaaatatggaagaagca
tgtaaggttaattttggcgttacatttccattgtttaaaaagattgatgtaaaaggtcct
aatgccgccccgttgtttaaatatttaacagaggaacaaaaagggttgttaggcagtaat
gtgaaatggaattttacaaagtttcttgtagaccgaaatggaaatgtcgtgaaaagattc
gcacccaaagataaaccagcaaaaatagaagatgacatcaaagcactcttataa

DBGET integrated database retrieval system