KEGG   Oceanobacillus iheyensis: OB0270Help
Entry
OB0270            CDS       T00093                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
oih  Oceanobacillus iheyensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OB0270
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    OB0270
Enzymes [BR:oih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     OB0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
302049..303323
Genome map
AA seq 424 aa AA seqDB search
MKWISSIVIMAVITVGVVYYYLQSGDEKTNHSNHNTSMGGTLDVSSLVDAMSLDEKIGQL
IVGGIDGTEINTDTKDMIENYHVGGVILFADNIESKAQTVNLMNDIKQVNENNPHPLLLG
VDEEGGSVTRMPDEITSLPPSGSIGKAQDEELAFEVGILLGQQMRGLGFNLNFAPVLDVN
SNPDNPVIGDRSFGDSPDIVTDMGIQSMKGIQSEGIISVVKHFPGHGDTSEDSHLKLPKV
DKSIEELSEVELVPFEKAISKGADVVMTAHILLPQIDTEYPASMSEKIISGLLREDMGFD
GVVISDDLTMGAITENIRIEEAAIQSVKAGSDMVLIAHHPDVVVSVHKKLKAAVQNGVIS
EAKIDESVERIIQLKRKYKLSNEETPQIDFQRINEKVEEILDQVSSTFSFDEFLVYSKFM
SIVL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggataagtagtattgtcattatggcggttattaccgttggagtggtttattat
tatttacaatcaggcgacgaaaaaactaatcattccaatcataatacttcaatgggtgga
acattggatgtatcgagtttggtagatgcgatgagtttagatgaaaagattgggcaattg
atcgttggtggaattgacggaacagaaataaatacggatacgaaagacatgattgaaaat
tatcatgttggaggagttattctgtttgcagacaatattgaaagcaaggcacaaactgta
aatcttatgaatgacataaaacaggtgaatgagaataatccacatccattgcttcttggg
gttgatgaagaaggtggaagcgtaacaagaatgccagacgagatcacaagtctcccacca
agtggatctataggaaaagcacaagatgaggaacttgcttttgaagttggtattcttctt
ggacagcaaatgcgaggattaggattcaatttaaatttcgctccggttcttgatgtgaat
agtaatccagataatcctgtaattggcgatcgttcctttggtgatagtccagacatcgtg
actgatatggggattcaatccatgaaaggaattcaaagtgaggggattatctctgtcgtc
aaacactttcctgggcatggagatacaagtgaggattcacatttaaagcttcccaaagtc
gataaaagtatagaggagctttcagaagtggaactggttccttttgaaaaagcaatttcc
aaaggagcagacgtggtgatgactgcacacatcttgttgccacaaatagatactgaatat
ccagcatctatgtctgaaaaaatcatttctggtctattgagagaagatatggggtttgat
ggagttgttatctcagacgatttaacaatgggagcaattacggaaaacattagaatagaa
gaagcggctatccaatctgtaaaagctggcagtgatatggtacttatcgcacatcatcca
gatgtagtggtatccgttcataagaagctaaaagcagccgtgcaaaatggtgttatttct
gaagcaaaaattgatgaaagtgtagaaagaattattcagctaaaaaggaaatataaactt
tcaaatgaggaaactccgcagatagattttcaacgaataaacgaaaaggtggaagagata
ctagatcaagtctcttccaccttttcgtttgatgaatttttagtatattccaaattcatg
tcaattgtactataa

DBGET integrated database retrieval system