KEGG   Oceanobacillus iheyensis: OB0270Help
Entry
OB0270            CDS       T00093                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
oih  Oceanobacillus iheyensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:oih00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:oih00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
302049..303323
Genome map
AA seq 424 aa AA seqDB search
MKWISSIVIMAVITVGVVYYYLQSGDEKTNHSNHNTSMGGTLDVSSLVDAMSLDEKIGQL
IVGGIDGTEINTDTKDMIENYHVGGVILFADNIESKAQTVNLMNDIKQVNENNPHPLLLG
VDEEGGSVTRMPDEITSLPPSGSIGKAQDEELAFEVGILLGQQMRGLGFNLNFAPVLDVN
SNPDNPVIGDRSFGDSPDIVTDMGIQSMKGIQSEGIISVVKHFPGHGDTSEDSHLKLPKV
DKSIEELSEVELVPFEKAISKGADVVMTAHILLPQIDTEYPASMSEKIISGLLREDMGFD
GVVISDDLTMGAITENIRIEEAAIQSVKAGSDMVLIAHHPDVVVSVHKKLKAAVQNGVIS
EAKIDESVERIIQLKRKYKLSNEETPQIDFQRINEKVEEILDQVSSTFSFDEFLVYSKFM
SIVL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggataagtagtattgtcattatggcggttattaccgttggagtggtttattat
tatttacaatcaggcgacgaaaaaactaatcattccaatcataatacttcaatgggtgga
acattggatgtatcgagtttggtagatgcgatgagtttagatgaaaagattgggcaattg
atcgttggtggaattgacggaacagaaataaatacggatacgaaagacatgattgaaaat
tatcatgttggaggagttattctgtttgcagacaatattgaaagcaaggcacaaactgta
aatcttatgaatgacataaaacaggtgaatgagaataatccacatccattgcttcttggg
gttgatgaagaaggtggaagcgtaacaagaatgccagacgagatcacaagtctcccacca
agtggatctataggaaaagcacaagatgaggaacttgcttttgaagttggtattcttctt
ggacagcaaatgcgaggattaggattcaatttaaatttcgctccggttcttgatgtgaat
agtaatccagataatcctgtaattggcgatcgttcctttggtgatagtccagacatcgtg
actgatatggggattcaatccatgaaaggaattcaaagtgaggggattatctctgtcgtc
aaacactttcctgggcatggagatacaagtgaggattcacatttaaagcttcccaaagtc
gataaaagtatagaggagctttcagaagtggaactggttccttttgaaaaagcaatttcc
aaaggagcagacgtggtgatgactgcacacatcttgttgccacaaatagatactgaatat
ccagcatctatgtctgaaaaaatcatttctggtctattgagagaagatatggggtttgat
ggagttgttatctcagacgatttaacaatgggagcaattacggaaaacattagaatagaa
gaagcggctatccaatctgtaaaagctggcagtgatatggtacttatcgcacatcatcca
gatgtagtggtatccgttcataagaagctaaaagcagccgtgcaaaatggtgttatttct
gaagcaaaaattgatgaaagtgtagaaagaattattcagctaaaaaggaaatataaactt
tcaaatgaggaaactccgcagatagattttcaacgaataaacgaaaaggtggaagagata
ctagatcaagtctcttccaccttttcgtttgatgaatttttagtatattccaaattcatg
tcaattgtactataa

DBGET integrated database retrieval system