KEGG   Oceanobacillus iheyensis: OB0406Help
Entry
OB0406            CDS       T00093                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
oih  Oceanobacillus iheyensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OB0406
Enzymes [BR:oih01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     OB0406
Exosome [BR:oih04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OB0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
432481..434394
Genome map
AA seq 637 aa AA seqDB search
MYHISAEDIYLFHQGTNFESHQFLGCHEINWKGKRGYRFAVWAPNALKVCVVGDFNNWEE
NSHPLEKFTDEGLWGGFIADIPPATSYKYHICSSEDTSILKADPFATQAERRPKTASVIP
AANGYQWSDDQWIEQRNTYDPYSSPISIYEVHLGTWKKTLKKQFLSYRELATQLIPYVKS
LGYTHIELLPINEHPFDRSWGYQITGYFAVTSRYGNPSDFKYFIDQCHQHQIGVILDWVP
GHFCKDDFGLRQFDGAPLYEYRDPKKSEKKSWGTLAFDYGRPEVQSFLISNAIYWLKEFH
IDGLRVDAVASMLYLNFDRYDEEEKIYNTYGGEENLEAFAFLRKLNKVVFSYIPGALMMA
EDSSDLPLVTAPVNKGGLGFNYKWNMGWMNDLLSFMEKESIHRKWHHNRLTFSFMYTYSE
NYLLPLSHDEVVHGKKSLLDKMPGDQWQQFANLRLLYGYMYTHPGKKLVFMGGELAQYAE
WKDTEELDWHLLEYPLHKGIYHYIKNLNELYQQHPELYELDHLSEGFEWIDPHNIDQSVI
AFRRKANKPNQELIIICNFTPQVHFDYKIGVPESGRYKEIFNSDSVRFGGSGQINEGEHF
SFPEKWHGLSQHIKIKVPPLAISVFQIEVERERLPRE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
ttgtatcatatatccgcagaagacatctacttattccatcaaggtacaaactttgagagt
catcaatttttaggatgccacgagataaactggaaaggaaaacgagggtatcgatttgct
gtttgggcacctaatgcgttaaaagtttgcgtggtaggtgattttaacaattgggaagaa
aatagccatcctttagagaagtttacggatgaaggtctttggggtggttttatagcagat
attccaccagcaacatcttataagtatcatatatgttcatctgaagacacttcaatatta
aaagcggatccattcgcaacgcaagcagagcgaaggcctaaaactgcatctgtaatcccc
gcagcaaatggttaccaatggagtgatgatcaatggatcgaacaaagaaatacttatgat
ccatattcatctccaatttccatttacgaagttcatttaggtacatggaaaaaaacactc
aaaaaacaatttttatcctaccgagaattagcaacacaactaataccatacgtaaaatcc
ctaggttacactcatatagaattattacccataaatgaacatccattcgaccgatcttgg
ggatatcaaatcacaggatattttgcggttacatcaagatatggaaacccatcggacttt
aaatattttattgatcaatgtcatcaacatcaaataggtgtcatcttagattgggtccct
ggacatttttgtaaagatgatttcggactgcggcaatttgacggagcaccactgtatgaa
tacagggatccgaaaaaatccgaaaaaaagtcatggggtacattagcgtttgattatggc
agacctgaagttcaaagctttcttatttccaatgcaatttattggttgaaagagttccat
attgatggacttcgtgtcgatgcagtagcgagcatgttgtatttgaactttgatcgatat
gatgaggaagaaaaaatatacaatacatacggtggggaggagaatctagaggcctttgcc
tttttgagaaagctaaataaagtcgttttttcttatataccaggtgccttaatgatggca
gaagatagttcggatttacctttagtaacagctcctgtaaataaaggtggactagggttt
aattataaatggaacatgggatggatgaatgatttgctttcttttatggagaaggaatcg
atacatcggaagtggcatcataaccggctgactttctcgtttatgtacacctattcggaa
aactatttattgccactctctcatgatgaggtcgtacacggcaagaaatcacttttagat
aaaatgcctggagatcaatggcagcaatttgcaaacttacgtctcctctatggatatatg
tatacacatcctggcaagaagctagtatttatggggggagaattagcgcaatatgcggaa
tggaaggacacggaggagttggactggcatttactagaatatccgctccacaaaggtatt
tatcactatattaaaaatttgaatgaattatatcagcaacatcctgaactttatgaattg
gatcacctaagtgaaggatttgagtggatagacccacataatattgatcaaagtgtaata
gcatttagaaggaaagcgaataaaccaaatcaagaattaattattatttgtaatttcaca
cctcaagttcattttgactataagattggcgttcctgaatctggaagatataaagaaatt
tttaattctgattcagtaaggtttggagggtctggtcaaataaatgaaggggaacatttt
agctttccggagaaatggcatggtttatcacagcatataaagattaaagtgccaccatta
gccatatccgtttttcaaatcgaagttgaaagggagagattgccgcgtgagtga

DBGET integrated database retrieval system