KEGG   Oceanobacillus iheyensis: OB0521Help
Entry
OB0521            CDS       T00093                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00260  Glycine, serine and threonine metabolism
oih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01130  Biosynthesis of antibiotics
oih01230  Biosynthesis of amino acids
Module
oih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OB0521
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OB0521
Enzymes [BR:oih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OB0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB NanE UPF0149
Motif
Other DBs
NCBI-ProteinID: BAC12477
JAMSTEC: OB0521
UniProt: Q8ESU5
Position
complement(553705..554493)
Genome map
AA seq 262 aa AA seqDB search
MGKSKLDAVLKEKTQAKKPIFVPYIMAGDGGIDNLNKRIQFLEEAGASAVELGIPFSDPV
ADGPVIQDAGQRALANKTTIGSVLEALESEKSQRNIPVVLMTYINPVWKYGFEQFARDCS
QAGVDGIIIPDIPMEEEDDVASSLTQHDIAFIRLAAMTSTEDRLERIAKRSEGFLYAVSV
TGTTGERAQHENDAFHFLEKLKQISHVPVLAGFGISTAERARELSAACDGVVVGSKIVQL
FEQGDEDGIHSLIRESIGEKVI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaagtaaactcgatgctgtattgaaagaaaaaacacaagccaaaaaacctata
tttgtaccttatattatggctggagatggtggcattgataaccttaacaaacgtattcag
tttttagaagaagcaggtgcttcggcagtggaacttggaattccattttctgatccggta
gcagatgggcctgtcattcaagatgcaggacaacgcgcgctggcaaataagactacgata
ggttctgtattagaagcattggaaagcgaaaaatcacagcgaaacatccctgttgtccta
atgacctatattaacccagtatggaaatatggatttgaacaatttgctagagattgctct
caagcaggtgtcgacggcatcattattccggatattccgatggaagaggaggacgatgta
gcatcttcgttaacgcagcacgatatcgcgtttatccgtttagctgccatgacaagtaca
gaagaccgtctggaaagaatagcaaaacgatcagaaggatttttatatgccgtatctgtg
actggtactacaggtgaacgcgctcaacacgagaatgatgcgttccactttttagaaaaa
ctgaagcaaataagccatgtaccagtattagctggatttggtatatccactgccgaacgc
gcaagagaactttctgccgcttgcgacggcgttgttgtaggaagtaaaattgtacagtta
tttgagcaaggagatgaagatggtattcactctcttatacgagagagtattggagaaaaa
gtcatttga

DBGET integrated database retrieval system