KEGG   Oceanobacillus iheyensis: OB0522Help
Entry
OB0522            CDS       T00093                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00260  Glycine, serine and threonine metabolism
oih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01130  Biosynthesis of antibiotics
oih01230  Biosynthesis of amino acids
Module
oih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OB0522
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OB0522
Enzymes [BR:oih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OB0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAC12478
JAMSTEC: OB0522
UniProt: Q8ESU4
Position
complement(554493..555692)
Genome map
AA seq 399 aa AA seqDB search
MTTYSFPNTKGKYGEFGGRFVPELLMPAVLELEKAYEDALKDESFNEELQTYLTEYIGRE
TPLYHAKKLTEHAGGAQIYLKREDLNHTGAHKINNTIGQALLTLRMGKKKVVAETGAGQH
GVATATVCSLLGLECIVFMGEEDIKRQKLNVFRMELLGAEVVSVSQGSGTLKDAVNEALR
YWVNNVNDTHYIIGSVVGPHPFPKIVRDFQSVIGKETKEQSMKKIGSLPDAVVACVGGGS
NAMGMFYPFIDDKEVTLFGVEAAGAGLDTKQHAATLTGGSPGMLHGTFTYLLQDDCGQIE
EAFSISAGLDYPGIGPEHSHLHQTKRVTYSSITDEEALEAFQLLSKTEGIIPALESAHAV
SYATKLAKEMNPEQSIVICLSGRGDKDVEQVKERLEGEQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgactacttattcatttccaaatacaaaaggaaaatatggagagtttggcggaagattt
gttccagaactattaatgcctgcagtacttgaattagaaaaagcgtatgaagatgcgttg
aaagatgagagttttaacgaggaacttcaaacatatttaacggaatacatcggacgtgaa
accccattatatcacgctaaaaagttaacggaacatgcaggcggcgcacaaatttattta
aaacgtgaagatttaaatcatactggtgctcataaaatcaataatacaattgggcaagca
ctactcacgttgcgaatgggcaagaaaaaagttgtagctgaaactggtgcaggacaacat
ggtgtagctacagcaacagtatgttctttattaggattagaatgtattgtttttatgggg
gaagaagatattaagcggcaaaagctaaatgtttttcgcatggaattgctaggggcggag
gtagtcagtgtctcccaaggtagtggaaccttaaaagacgctgtgaacgaagcgcttcgc
tactgggtaaataatgtcaatgacactcattatattatcggatcagtcgttggacctcat
cctttcccaaaaattgttcgcgactttcaatccgtgataggcaaagaaaccaaagaacaa
agtatgaaaaaaataggttccttacccgatgctgttgtcgcatgcgttggtggcggaagt
aatgcgatgggcatgttctacccatttatcgatgataaggaagtgactttattcggtgta
gaagctgcaggagcaggattagataccaaacaacatgcagcgacccttactggtggctct
ccaggtatgttgcatggaacatttacgtatctgcttcaagatgattgtggacaaattgaa
gaagcattctctatctcagcaggtcttgattatccaggaattggaccagaacatagtcac
cttcaccagacgaaaagagtaacatactcctcgattacagatgaggaagcacttgaagct
tttcaactcttatccaaaacagaaggcattattcctgcattagagagcgcacatgcagtt
agttatgctacaaagttagctaaggaaatgaatcctgagcaatctatcgttatttgctta
tctggtagaggggataaagacgtcgagcaagtaaaagaaagactggagggggaacaataa

DBGET integrated database retrieval system