KEGG   Oceanobacillus iheyensis: OB0524Help
Entry
OB0524            CDS       T00093                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01130  Biosynthesis of antibiotics
oih01230  Biosynthesis of amino acids
Module
oih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OB0524
Enzymes [BR:oih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     OB0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE QRPTase_C SOR_SNZ Cellulase DHO_dh NeuB ThiG IMPDH
Motif
Other DBs
NCBI-ProteinID: BAC12480
JAMSTEC: OB0524
UniProt: Q8ESU2
Position
complement(556304..557089)
Genome map
AA seq 261 aa AA seqDB search
MTFLAKILEEKQTEVNSRKQEKIDFGSRNIPVHSFIQLINQASSLSIIAEIKRASPSKGE
IQMDIDPVEQAIKYEQAGASAISVLTDQRFFKGSLNDLQQVSEAVSIPVLCKDFIIDEIQ
IDDAKDAGASIILLILAALPLERFQELYNYATKQGLEVICEVHTAEELKNALTISPAIIG
INNRNLKSFDVDLQTTKQLAQRVDTNKTIIISESGMRTASDATLAAESGAKAILVGETFM
RSNQLETDFNNLRVPLVERSI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacttttctagcaaaaatcttagaggaaaagcaaacggaagttaacagtagaaaacaa
gagaaaatcgatttcggaagtagaaatataccagtgcactcgtttattcaactaatcaat
caagcaagctcattatctattatcgccgaaataaaacgcgcctctccatcaaaaggagaa
attcaaatggacattgatcccgtcgagcaagctataaagtatgagcaagcaggtgcatca
gccatatctgtattaacagatcaacgttttttcaaaggttcattaaacgatttacaacaa
gtaagtgaagccgtttcaattccagttctttgtaaagattttattatcgatgaaattcaa
attgatgatgcaaaagatgcaggagcttctattattctgttaattctagcagctttacca
ttagagagattccaagaattatataattatgctacaaagcaaggacttgaggtcatatgt
gaagtgcatacagcagaagaattaaaaaatgccttaacgatatccccagcaatcattggc
ataaataatcgtaacttaaaatcttttgacgttgatttacaaactacgaaacaattggct
caacgagttgataccaataaaacgattatcatcagtgaaagcggcatgagaactgctagt
gatgcaacactagctgctgaatctggagcaaaagcgattttagttggagaaacatttatg
aggtcgaatcaattagaaactgattttaataatctacgcgttcctcttgtggaaaggagt
atatag

DBGET integrated database retrieval system