KEGG   Oceanobacillus iheyensis: OB0772Help
Entry
OB0772            CDS       T00093                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
oih  Oceanobacillus iheyensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OB0772
Enzymes [BR:oih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     OB0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
825121..826185
Genome map
AA seq 354 aa AA seqDB search
MDNLVKQLSELNGPCGYEQNVAYFIRDYVEDKVDSVQVDAMGNVIARKKGGKPGPVTLIT
AHMDEVGFIIKKIENNGLLRFEKLGGHDDRILLAQSVKVLGSKQELDGVIGTMSAHFVKF
DDPKKVRQHANLYIDIGATSKQTALEMGVEVGTPVTWATKSRIIGPEDKQLIVGKALDDR
AGCAVLLSVLNEIDKQEFAGEIVFLFTVQEEVGLRGAQTAINGLEDVDVAIAIDTTAVSD
TPEETMDQSLFLGEGTGIKVLDFSLIVQKSILEELKKIAVQEEIIHQLEVFPGIGTDGGA
VAVANKGIPTGVLSIPSRYAHSPVEAISLSDLIATKELVKAFIFNLNEDTKFTF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccttgtaaaacaactaagtgaattaaacggtccttgtggctacgaacaaaat
gttgcttattttattcgtgattatgtagaggataaagtggacagtgttcaagttgatgcc
atgggaaatgtgattgcaagaaaaaagggcggaaaaccggggcctgtaacacttataaca
gctcatatggatgaggtcggttttattataaagaaaattgagaataatgggttattacgt
tttgaaaaattgggtggacatgacgatcgcattttgctggcacagtcagtaaaagtacta
ggttcgaagcaagagcttgatggagtaattggaacaatgtctgcacattttgtgaaattt
gacgatcctaaaaaagtacgccaacatgctaatttatacatagatattggggcaacatcg
aaacagactgctcttgaaatgggagtagaagttggaacacctgttacatgggcgactaag
agcaggattattggtcctgaagataagcaattgattgttggaaaagcacttgatgatcgg
gcaggatgtgctgtacttttatctgtattaaatgagattgacaaacaagaatttgctgga
gaaattgttttccttttcactgttcaagaggaagttggattacgtggtgcacaaacggca
attaatggtttggaagacgtagacgtagctatcgcaattgatacgactgctgtaagtgat
actcctgaagaaaccatggatcaaagtcttttccttggtgagggaactggaataaaggtg
ttggattttagcttgattgtacaaaagagcatattagaagaattgaaaaaaatcgcagtc
caagaagaaattattcatcagttggaagtctttcctggaattggaacagatggaggagca
gtagctgtagcaaataaaggcataccaacaggggtgctatcgattccttcccgttacgca
cattctcctgttgaagcaatcagcctatccgatttaattgcaacaaaagaactagtgaaa
gcatttatatttaacttaaatgaagatacaaaatttacattttaa

DBGET integrated database retrieval system