KEGG   Oceanobacillus iheyensis: OB0772Help
Entry
OB0772            CDS       T00093                                 

Definition
(GenBank) endoglucanase
Organism
oih  Oceanobacillus iheyensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JAMSTEC: 
Position
825121..826185
Genome map
AA seq 354 aa AA seqDB search
MDNLVKQLSELNGPCGYEQNVAYFIRDYVEDKVDSVQVDAMGNVIARKKGGKPGPVTLIT
AHMDEVGFIIKKIENNGLLRFEKLGGHDDRILLAQSVKVLGSKQELDGVIGTMSAHFVKF
DDPKKVRQHANLYIDIGATSKQTALEMGVEVGTPVTWATKSRIIGPEDKQLIVGKALDDR
AGCAVLLSVLNEIDKQEFAGEIVFLFTVQEEVGLRGAQTAINGLEDVDVAIAIDTTAVSD
TPEETMDQSLFLGEGTGIKVLDFSLIVQKSILEELKKIAVQEEIIHQLEVFPGIGTDGGA
VAVANKGIPTGVLSIPSRYAHSPVEAISLSDLIATKELVKAFIFNLNEDTKFTF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccttgtaaaacaactaagtgaattaaacggtccttgtggctacgaacaaaat
gttgcttattttattcgtgattatgtagaggataaagtggacagtgttcaagttgatgcc
atgggaaatgtgattgcaagaaaaaagggcggaaaaccggggcctgtaacacttataaca
gctcatatggatgaggtcggttttattataaagaaaattgagaataatgggttattacgt
tttgaaaaattgggtggacatgacgatcgcattttgctggcacagtcagtaaaagtacta
ggttcgaagcaagagcttgatggagtaattggaacaatgtctgcacattttgtgaaattt
gacgatcctaaaaaagtacgccaacatgctaatttatacatagatattggggcaacatcg
aaacagactgctcttgaaatgggagtagaagttggaacacctgttacatgggcgactaag
agcaggattattggtcctgaagataagcaattgattgttggaaaagcacttgatgatcgg
gcaggatgtgctgtacttttatctgtattaaatgagattgacaaacaagaatttgctgga
gaaattgttttccttttcactgttcaagaggaagttggattacgtggtgcacaaacggca
attaatggtttggaagacgtagacgtagctatcgcaattgatacgactgctgtaagtgat
actcctgaagaaaccatggatcaaagtcttttccttggtgagggaactggaataaaggtg
ttggattttagcttgattgtacaaaagagcatattagaagaattgaaaaaaatcgcagtc
caagaagaaattattcatcagttggaagtctttcctggaattggaacagatggaggagca
gtagctgtagcaaataaaggcataccaacaggggtgctatcgattccttcccgttacgca
cattctcctgttgaagcaatcagcctatccgatttaattgcaacaaaagaactagtgaaa
gcatttatatttaacttaaatgaagatacaaaatttacattttaa

DBGET integrated database retrieval system