KEGG   Oceanobacillus iheyensis: OB1029Help
Entry
OB1029            CDS       T00093                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
oih  Oceanobacillus iheyensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OB1029
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    OB1029
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OB1029
Enzymes [BR:oih01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     OB1029
Exosome [BR:oih04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OB1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
1068442..1069773
Genome map
AA seq 443 aa AA seqDB search
MLKKVGWISVISLLIFAGIMGASFGNEEDATSAKGNNKKVENVIYMIPDGFSSDYASNYR
AYKGEEVVWDSHLKGLFTTHSADSDVTDSAAAGTAMATGEKTNNGVIGKDTNGNNLETIL
EKSKQHHKATGLVATSTITHATPAAFATHVEDRNNETEIARQLIKSEVDVLLGGGMNKFI
GEEEGGNQEDGELMQKAQDTGYILAENKQEMLEQNIDIKKDEKLLGLFADEALSPELHRK
DTEEPSLEDMTTHAIDQLNQNKKGFFLMVEGSQIDWAGHDNDSAYAMSDTEAFEKAVQAA
IDFAEEDGETLVVVAADHDTGGMTTGGYDQMELNANILNDVTATGEYMANQLDEERSNVH
EVVNTYTGFKLTEEEIESIETAEDPKLAINHVVSARSTIGWTSTGHTAADIPIYAYGPSA
ESFSGKLDNTDIPKLIEKAMKLK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaagaaggtaggatggatttcagtaataagtctattaatctttgcaggaattatg
ggagcatcttttggtaacgaagaagatgcaacatcagcaaagggtaataataaaaaagta
gagaatgtaatatatatgattccagatggatttagttcagattatgcttctaattaccgt
gcctataaaggagaagaagtagtatgggattctcacttaaaaggtctttttacaacacat
tcagcagattcagatgttactgattcggcagcagccggcacagcaatggctacgggtgag
aaaacaaacaatggtgttattggtaaagatacgaatgggaataatttagaaactatttta
gaaaaatccaaacaacatcataaagcaaccggattagtagctacatcaacaattacacac
gcaactccagctgcatttgcaacccatgtagaagatagaaataatgaaacggagattgca
cgacaattaattaaatctgaagtggatgttttacttggtggaggaatgaacaaatttatt
ggcgaagaagaaggcggtaatcaagaagatggtgagctaatgcaaaaggctcaagatacg
ggctatatcttagctgaaaataaacaggaaatgctagaacaaaatatagatatcaagaaa
gacgaaaaattacttggcttgtttgcagatgaagcgttatctccagaacttcatagaaaa
gatacggaagaaccaagtttagaggacatgactacacatgcgattgatcaactgaatcag
aataaaaaaggatttttcttaatggtggaaggtagtcaaattgattgggctggtcatgat
aatgattctgcctatgcgatgagtgatactgaagcatttgaaaaagcagttcaagctgca
attgattttgctgaagaggatggagaaacattagttgtagttgcggctgatcatgataca
ggaggaatgacaactggtggatatgaccagatggaattaaatgcaaacattcttaatgat
gtaacagcaactggagaatatatggctaatcaactagatgaagagcgttctaatgtccat
gaagtcgtaaatacgtatacaggatttaaattgacagaagaagaaatagaatctattgaa
acagcagaagatccaaaacttgctatcaatcatgtcgttagtgcacgatctaccattggt
tggacaagtactggtcacactgctgcagatattccgatttatgcatatggtccaagtgca
gaatcattttctggcaaattggataacactgatattccaaagttaatagaaaaggcgatg
aaattaaaataa

DBGET integrated database retrieval system