KEGG   Oceanobacillus iheyensis: OB1090Help
Entry
OB1090            CDS       T00093                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oih  Oceanobacillus iheyensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OB1090
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OB1090
  Amino acid metabolism
   00310 Lysine degradation
    OB1090
Enzymes [BR:oih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OB1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
1139507..1140775
Genome map
AA seq 422 aa AA seqDB search
MQEIKIPELAESITEGTIAEWLVKKGDKVEKGDPVVELETDKVNVEVNAEFSGVITEIIS
EEGDDVTVGDTIAKLDENGEAGSNSDESEPKEEPKQEEKQEDDKKKASETETSKGAETKS
ESNGEVIASPAARKRARELNIDLSSVQSRDPLGRVRTEDVEAQAQANKQPAEKKQEKKDA
PKSEKTEFDKPVERVKMTRRRQTIAKNLVEVQHNTAMLTTFNEVDMTAVMELRKQRKDKF
LDKNGVKLGFMSFFTKAVVGALKEFPLLNAEIQGNELVIKKFYDIGIAVSTDDGLVVPVV
RDADRKDFAGIEQDINDLGIKARDNKLTLKDLQGGSFTITNGGTFGSMMSTPILNAPQVG
ILGMHNIVKRAMVMPDDSIEVRPMMYLALSYDHRIVDGKEAVQFLVRIKQMLEDPYDLLL
EG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaaattaaaatcccagaattagcagaatccattacagaaggtacaatagcagaa
tggcttgtcaaaaaaggtgacaaagttgaaaaaggtgatccagtagtagaattagagacg
gataaagtaaatgtagaagtaaatgcagaattttccggagtcatcactgaaattattagt
gaagagggtgatgatgtaactgttggagatacgatagctaagttagatgaaaatggtgaa
gctggttccaattcagatgaatcagaacctaaagaagaacctaaacaagaagaaaagcaa
gaagacgataagaagaaagcgtctgaaacagaaacttccaagggagcggaaaccaagtct
gaaagtaatggagaagtgatcgcatctcctgcagctagaaaacgagcacgtgaattaaat
attgatttaagcagtgttcaatcacgtgacccattaggacgtgtacgcacagaagatgtt
gaagcacaagcacaggcgaataaacaacctgccgagaagaaacaagagaaaaaagatgct
ccaaaatcggagaaaacggagtttgacaaaccggtagaaagagtgaaaatgactcgtcgc
cgtcaaacaatcgcaaaaaatcttgtagaagtacagcataatacggcaatgctaactact
tttaacgaagtagatatgacagcggttatggaattacgaaaacaacgtaaagataaattc
ttagacaaaaatggcgttaagttaggattcatgtccttctttacaaaagcggttgtaggg
gctctaaaagaattcccattattaaatgctgaaattcagggaaatgaattagtcattaag
aaattctatgacatcggtattgctgtctccacggatgatggacttgtagtgccagtagtc
agagatgcagaccgtaaagattttgctgggattgagcaagatattaacgatttaggcata
aaagcacgagataataaattgacgttaaaagacttgcaaggtggatcatttacgattaca
aacggagggacatttggttccatgatgtctacaccaatcttaaatgcacctcaagtaggt
atcttaggaatgcacaatatagtaaaacgtgcaatggtaatgccagatgattctattgaa
gttcgtcctatgatgtacttggctctatcttatgaccaccgtattgtcgacggtaaggaa
gctgtacaattccttgttcgaattaagcaaatgttagaagatccatatgatcttttactt
gaaggttaa

DBGET integrated database retrieval system