KEGG   Oceanobacillus iheyensis: OB1414Help
Entry
OB1414            CDS       T00093                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00010  Glycolysis / Gluconeogenesis
oih00020  Citrate cycle (TCA cycle)
oih00620  Pyruvate metabolism
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01130  Biosynthesis of antibiotics
oih01200  Carbon metabolism
Module
oih_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB1414 (pdhC)
   00020 Citrate cycle (TCA cycle)
    OB1414 (pdhC)
   00620 Pyruvate metabolism
    OB1414 (pdhC)
Enzymes [BR:oih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     OB1414 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H ATP-synt_ab_Xtn QRPTase_N NQRA RnfC_N
Motif
Other DBs
NCBI-ProteinID: BAC13370
JAMSTEC: OB1414
UniProt: Q8CXJ1
Position
1457309..1458592
Genome map
AA seq 427 aa AA seqDB search
MAFNFKLPDIGEGIHEGEIVKWFVKEGDEVKEDDVLCEVQNDKSVVEIPSQVDGKVTKIH
VAEGDVAVVGDTLISFEAEGYDDEEGDSADDSSSDSKEEKSTDSKEEEKEASKEESSEQS
DDTRVIAMPSVRKFARDNDVNIKDVNGTGKNGRILKEDVESYLSGDQPSSEVAEDKAEAS
SEDKQETKAAPQGQYPETREKMTAIRKSIAKSMVNSKSKAPHVTLMDEIDVTELVAHRKK
FKAVAAEQDIKLTYLPYVVKALVSASKKFPILNSYIDENTDEIVEKHYYNIGIAADTDRG
LLVPVVKDSDKKSIFQISQEINELAGKARDGKLKPDEMKGASNTISNIGSAGGQWFTPVL
NYPEAVILGIGRIADKPVVRDGEIVVAPVLSVSLSFDHRIVDGATAQLALNQIKRLLNDP
QLIMMEA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaattttaagttaccggatatcggtgaaggtatacatgaaggtgaaatagta
aaatggttcgtaaaagaaggcgacgaagtaaaagaagatgatgtactttgtgaagtacaa
aatgataaatccgttgtagaaattccttctcaagtagatggaaaagttacaaagattcac
gttgctgaaggtgacgttgcagttgtaggagatacactaatttcttttgaagcagaaggt
tatgatgatgaagaaggcgacagtgctgatgattcatcttcagattcaaaagaagagaaa
tcaacggattcgaaagaagaagaaaaagaagcttctaaagaagagtcaagtgagcaatct
gatgatactcgagtgattgcaatgccttctgtacgcaaatttgcacgtgataatgatgtt
aatattaaagatgttaacggaactggtaaaaatggacgtattcttaaagaagatgtagaa
agctacctaagcggtgatcagccatctagtgaagtagccgaggacaaagctgaagcttct
tctgaagataagcaagaaacgaaagctgcacctcaaggtcaatatccagagactcgtgag
aagatgactgcaatccgtaaatctattgctaaatcaatggttaactcgaaatcaaaagca
ccacatgttacactaatggacgaaattgatgtaactgaattagtagcacatcgtaagaag
tttaaagcagttgctgctgagcaagatattaaattaacttatttaccatatgtagttaaa
gcattagtatctgcgtctaagaaattccctattctaaattcttatattgatgagaataca
gatgaaattgttgagaaacattattacaacattggtattgcagcagacacagatagaggt
ctactagttccagttgtaaaagattctgataagaaatctattttccaaatttctcaagaa
atcaatgaattggcagggaaagctcgagatggtaaacttaaacctgatgagatgaaaggt
gcttctaacactatttctaatattggttctgctggtggacagtggtttactccagtatta
aattatccagaagcagtaattctaggtatcggacgtattgctgataaaccagttgttcgc
gatggagaaattgttgtagctccagttctctctgtatctctaagctttgatcatcgtatc
gttgacggcgcaacagcacaacttgcactaaatcaaattaaacgattattgaatgatcca
caattaattatgatggaggcgtaa

DBGET integrated database retrieval system