KEGG   Oceanobacillus iheyensis: OB1488Help
Entry
OB1488            CDS       T00093                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
oih  Oceanobacillus iheyensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OB1488 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OB1488 (pyrB)
Enzymes [BR:oih01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     OB1488 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
1527878..1528807
Genome map
AA seq 309 aa AA seqDB search
MRHFISVNQLEADEMYQIIRKANELRDRPNQLNRQLFAGNLFFEPSTRTKMSFSVAERKL
GVEILDFHTEASSLAKGESLYDTAKTFEAIGANFLVIRHPSDQWISELEQGGKLNIPVIN
AGSGKEEHPTQCLLDLLTMYQEFGSIKGLKVVIAGDIKHSRVAKSNAMALTKLGAKVIFS
AAPGFEDHTLDYPYLTMDEAIEEADVLMLLRIQHERHLHKAETSDYLSLYGLTKERYKKL
QDHAILMHPAPINRGVEIDTNLVESEKSRIFKQMSNGVYVRMAIIMHVLSEWGIIHENNL
IKRKSLTAI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagacattttatttctgttaatcaattggaagccgatgaaatgtatcaaataatacga
aaagcaaatgaattaagagaccgaccaaatcaattaaatcgccaattatttgctggtaat
ctgttttttgaaccgagtactcgaacaaaaatgagtttttcagttgcggaacgaaagtta
ggtgtggagatattggatttccatacagaagcatcgagtttggcaaaaggtgaatcgtta
tatgatacagcaaaaacatttgaagcgattggggctaatttcttagtaataagacatcct
tcagatcaatggataagtgaattggagcagggaggaaaattaaacataccagtcattaat
gctggttctggcaaagaagaacatccaactcaatgtttgcttgatctactaacgatgtat
caagagtttggttcaattaaagggttgaaggttgtgattgctggagatataaaacatagt
cgagtagctaaatccaatgcaatggcgcttacgaaactaggtgcgaaagtaatttttagt
gccgcaccaggatttgaggaccatacgttagattatccatacctgaccatggatgaagcc
atagaagaagctgacgtgttaatgttactgagaattcaacatgagcgacatctgcataaa
gcagagacttcagattacctatcactctatggtttaacgaaagaaagatataaaaagtta
caagatcatgcaattcttatgcatccagctccgataaatcgtggggtagaaatagataca
aatttagtagagagtgaaaaatcaaggatttttaaacaaatgtccaatggggtttacgta
cgaatggcaattatcatgcacgtattatcagaatgggggattattcatgaaaacaatctt
attaaacgcaaatcgcttactgccatctaa

DBGET integrated database retrieval system