KEGG   Oceanobacillus iheyensis: OB1578Help
Entry
OB1578            CDS       T00093                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
oih  Oceanobacillus iheyensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:oih02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:oih02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
UniProt: 
Position
1616722..1617780
Genome map
AA seq 352 aa AA seqDB search
MRKVRAIVIDDSAFMRKIISDILDNDPRIEVVAVARNGEDGLNKVIQLSPDVVTLDVHMP
KMDGMQALQRIMNEHPVPVVMLSSVTKAGAEKTIQAISNGAVDFIMKPSGSISLDIRNVE
DEIRKKVILASTVRVKSTQEASEEDFQSTRTVPTINREKKYRRSIVSIGTSTGGPKALQK
VLTELPKDIQAPIVIVQHMPPGFTKSLADRLNSICAISVKEAVHGEILQSGTAYIAPGGF
HMQVENVGMSLAIALDKSPPLKGHRPSVNKLFSSLQHIKNYNKITCILTGMGNDGTDGLQ
QLRLNEGSTISLAESADTAIVYGMPKAAVNAGLIDYEMSLHEIPSLIVKQLT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagttcgggcaatagtaattgatgactccgcatttatgaggaaaataatttcc
gatattttagataacgacccaagaattgaagtggtagctgttgcccgaaacggtgaagat
ggactaaataaagtcatacagctatcaccggatgtggtaacccttgatgtgcatatgcca
aaaatggatggcatgcaagcattacaacgaattatgaatgaacaccccgttcctgtagta
atgttatccagtgttacgaaagcaggagcagaaaaaacaattcaagccatttcaaatggc
gctgtagactttatcatgaagccctcaggttcgatttcattagatattcgaaatgtagag
gacgaaattcgaaaaaaggttatattggcttctacggttagggtgaaatctacccaagaa
gcgtccgaggaagattttcaatcgacaaggaccgttcctactataaatagagaaaaaaag
tatcgaagaagtatagtttctatcggtacttctacgggcggaccgaaagcattacaaaag
gttttaacagaattgcctaaagatatacaagctccaatcgttattgtacagcatatgcca
cctggctttacaaaatcattagctgatcgattaaattccatttgtgccatttcagttaaa
gaagcggttcacggagaaatattgcaatctggtactgcttatattgcaccaggaggtttt
catatgcaggtggagaatgtaggtatgtccttagcaatagcgttagataaatctcctcca
ttaaaagggcatcggccatctgtaaataaactttttagttctcttcaacatattaaaaat
tacaataagattacgtgcattttaacgggaatgggaaacgatggaacggatggtctacag
caattaaggttaaatgaggggtctacgatatctttggcagaatcagcagatactgccatt
gtatatggaatgccaaaagctgcagtaaatgcagggttaatcgattatgaaatgtcttta
catgaaatacctagtttgatagtaaaacaattaacataa

DBGET integrated database retrieval system