KEGG   Oceanobacillus iheyensis: OB1732Help
Entry
OB1732            CDS       T00093                                 

Definition
(GenBank) hypothetical conserved protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00010  Glycolysis / Gluconeogenesis
oih00260  Glycine, serine and threonine metabolism
oih00680  Methane metabolism
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01130  Biosynthesis of antibiotics
oih01200  Carbon metabolism
oih01230  Biosynthesis of amino acids
Module
oih_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oih_M00002  Glycolysis, core module involving three-carbon compounds
oih_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB1732
  Energy metabolism
   00680 Methane metabolism
    OB1732
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OB1732
Enzymes [BR:oih01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OB1732
Membrane trafficking [BR:oih04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    OB1732
Exosome [BR:oih04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OB1732
  Exosomal proteins of melanoma cells
   OB1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAC13688
JAMSTEC: OB1732
UniProt: Q8EQG8
Position
complement(1775556..1776107)
Genome map
AA seq 183 aa AA seqDB search
MKRIYFIRHCSAEGQHPDAPLTNLGLQQANELSLFLQNTNESFCGIWSSPYLRAIDTIKP
FSNYLNLEINIDDRLKERVLCAEPTEDWMDALKQSFEDPEFYLPGGESASTLLQRANAVL
TPLINNPKLTNIIIVSHGNILSHLFHQFNGDFGFEDWKTLGNPDVYALDINSSTNMKLTP
IYK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaatatatttcattcgacactgttctgcagaaggacaacatcctgacgctcct
ttaacaaacctagggttgcaacaagcaaatgaattatcattatttctccaaaatacgaat
gaatcgttctgcggcatatggtcaagtccttatttgcgagctatagacacaataaaaccg
ttttcaaactatctaaatttggaaataaatattgatgatcgtttaaaagaacgggtctta
tgcgcagagccaacagaggattggatggacgcattaaaacagtcttttgaagatccagaa
ttctatttgccaggcggtgaatccgcatctacacttttacaaagagcaaacgcagtttta
acccctttaataaacaatcctaaattaactaatattatcatcgtcagtcatggcaatata
ttatctcatttatttcatcaatttaatggtgattttggtttcgaagattggaaaacactt
ggaaatcctgatgtatatgcattagatattaattctagtactaacatgaaattaacacct
atttataaataa

DBGET integrated database retrieval system