KEGG   Oceanobacillus iheyensis: OB1732Help
Entry
OB1732            CDS       T00093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
oih  Oceanobacillus iheyensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OB1732
   01230 Biosynthesis of amino acids
    OB1732
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OB1732
  Energy metabolism
   00680 Methane metabolism
    OB1732
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OB1732
Enzymes [BR:oih01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OB1732
Exosome [BR:oih04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OB1732
  Exosomal proteins of melanoma cells
   OB1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JAMSTEC: 
Position
complement(1775556..1776107)
Genome map
AA seq 183 aa AA seqDB search
MKRIYFIRHCSAEGQHPDAPLTNLGLQQANELSLFLQNTNESFCGIWSSPYLRAIDTIKP
FSNYLNLEINIDDRLKERVLCAEPTEDWMDALKQSFEDPEFYLPGGESASTLLQRANAVL
TPLINNPKLTNIIIVSHGNILSHLFHQFNGDFGFEDWKTLGNPDVYALDINSSTNMKLTP
IYK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaatatatttcattcgacactgttctgcagaaggacaacatcctgacgctcct
ttaacaaacctagggttgcaacaagcaaatgaattatcattatttctccaaaatacgaat
gaatcgttctgcggcatatggtcaagtccttatttgcgagctatagacacaataaaaccg
ttttcaaactatctaaatttggaaataaatattgatgatcgtttaaaagaacgggtctta
tgcgcagagccaacagaggattggatggacgcattaaaacagtcttttgaagatccagaa
ttctatttgccaggcggtgaatccgcatctacacttttacaaagagcaaacgcagtttta
acccctttaataaacaatcctaaattaactaatattatcatcgtcagtcatggcaatata
ttatctcatttatttcatcaatttaatggtgattttggtttcgaagattggaaaacactt
ggaaatcctgatgtatatgcattagatattaattctagtactaacatgaaattaacacct
atttataaataa

DBGET integrated database retrieval system